Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1530 bp · TkA06G342890|TK1151|cDNA
ATGTTACGACCCGGGTTGAACCAACTCCGAAGGCCCGACATCGTTGGGGTGTATTGGGCTGCTAGACCTTACGATGCCGGGCCTTCGGAGTTGGTCCAACCCGGGTCGTTGTTACGACCCGGGTTGGACCAACTCCGAAGGCCCGGCATCATAAGTCACAAGGGCTGCTATCACCAGTTGAGCTGCAGCTCAACTGGTGATAGCAGCCCTTGTGACTGGCTATTAAAGGGTGAGGTCTCAGACAAACAGGGTGAGGGTCT...
1530 bp · TkA06G342890|TK1151|CDS
ATGTTACGACCCGGGTTGAACCAACTCCGAAGGCCCGACATCGTTGGGGTGTATTGGGCTGCTAGACCTTACGATGCCGGGCCTTCGGAGTTGGTCCAACCCGGGTCGTTGTTACGACCCGGGTTGGACCAACTCCGAAGGCCCGGCATCATAAGTCACAAGGGCTGCTATCACCAGTTGAGCTGCAGCTCAACTGGTGATAGCAGCCCTTGTGACTGGCTATTAAAGGGTGAGGTCTCAGACAAACAGGGTGAGGGTCT...
Protein
Download Protein FASTA509 aa · TkA06G342890|TK1151|PROTEIN
MLRPGLNQLRRPDIVGVYWAARPYDAGPSELVQPGSLLRPGLDQLRRPGIISHKGCYHQLSCSSTGDSSPCDWLLKGEVSDKQGEGLGYNVVPPPFNDNYTPPLEPIVLRRPPPGSQPSVPVLVQIEKQVDHVKVNESNSSTSCAYEVLVEDWVEEDENVSVSIENSLNTKILSPVVSNNWVTQDTKTVSSGSSKTDGLALLNSNDNPPTVEKYKPKSCGIAGHIARNCPNPPAVQVHAHHLKNISKGDSSRIKPSRSCS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G342890 |
|---|---|
| TK1151 ID | TkA06G342890 |
| OH-1004 ID | LXL04_015014 |
| Relationship / confidence | Non Reciprocal Best Hit / Complex relationship |
| Protein identity (%) | 65.000 |
| Protein coverage (%) | TK1151 72.102 / OH-1004 14.508Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G342890 |
|---|---|
| Location | Chr06:85211834-85215610 (-) |
| Description | Protein of unknown function |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0009409 response to cold Biological Process GO:0009414 response to water deprivation Biological Process GO:0009631 cold acclimation Biological Process GO:0009651 response to salt stress Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005886 plasma membrane Cellular Component GO:0003690 double-stranded DNA binding Molecular Function GO:0003697 single-stranded DNA binding Molecular Function GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function GO:0008270 zinc ion binding Molecular Function |
| KEGG gene cross-reference | ath:AT4G36020 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF15288zf-CCHC_6214-230 aaPF13696zf-CCHC_2217-231 aaPF14392zf-CCHC_4218-230 aaPF00098zf-CCHC219-231 aaPF30379SLU7_N219-229 aaPF30379SLU7_N328-349 aaPF00098zf-CCHC331-347 aaPF14392zf-CCHC_4331-346 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G342890 | PF15288 | zf-CCHC_6 | 214 | 230 | 0.6 | 10.8 |
| TkA06G342890 | PF13696 | zf-CCHC_2 | 217 | 231 | 1.3 | 9.7 |
| TkA06G342890 | PF14392 | zf-CCHC_4 | 218 | 230 | 0.52 | 10.7 |
| TkA06G342890 | PF00098 | zf-CCHC | 219 | 231 | 2.1e-11 | 44.1 |
| TkA06G342890 | PF30379 | SLU7_N | 219 | 229 | 9.6e-07 | 28.9 |
| TkA06G342890 | PF30379 | SLU7_N | 328 | 349 | 9.6e-07 | 28.9 |
| TkA06G342890 | PF00098 | zf-CCHC | 331 | 347 | 2.1e-11 | 44.1 |
| TkA06G342890 | PF14392 | zf-CCHC_4 | 331 | 346 | 0.52 | 10.7 |
| TkA06G342890 | PF15288 | zf-CCHC_6 | 332 | 348 | 0.6 | 10.8 |
| TkA06G342890 | PF13696 | zf-CCHC_2 | 332 | 346 | 1.3 | 9.7 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.