TkA06G328690 | RubberDandelionOmics

Gene overview

TkA06G328690

Reference: TK1151 Chr: Chr06 Coordinates: 82046098-82049569 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1491 bp · TkA06G328690|TK1151|cDNA

ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGATTGGCTGTAGGGCTTGCTTCTATTGGACCTGGAGTTGGTCAAGGTACTGCTGCGGGTCAAGCTGTAGAAGGTATCGCGAGACAGCCCGAGGCGGAGGGAAAAATACGAGGTGATGGCATTGCTCGTATTCATGGTCTTGATGAAGTAATGGCGGGTGAATTAGTAGAATTTGAAGAAGGGAGTTCTGTAAAAGCAACAGGAAGAATTGCTCAGATACC...

CDS

Download CDS FASTA

1491 bp · TkA06G328690|TK1151|CDS

ATGAATCCACTGATTTCTGCCGCTTCCGTTATTGCTGCTGGATTGGCTGTAGGGCTTGCTTCTATTGGACCTGGAGTTGGTCAAGGTACTGCTGCGGGTCAAGCTGTAGAAGGTATCGCGAGACAGCCCGAGGCGGAGGGAAAAATACGAGGTGATGGCATTGCTCGTATTCATGGTCTTGATGAAGTAATGGCGGGTGAATTAGTAGAATTTGAAGAAGGGAGTTCTGTAAAAGCAACAGGAAGAATTGCTCAGATACC...

Protein

Download Protein FASTA

496 aa · TkA06G328690|TK1151|PROTEIN

MNPLISAASVIAAGLAVGLASIGPGVGQGTAAGQAVEGIARQPEAEGKIRGDGIARIHGLDEVMAGELVEFEEGSSVKATGRIAQIPVSEAYLGRVINALAKPIDGRGEISSSEYRLIESPAPGIISRRSVYEPLQTGLIAIDSMIPIGRGQRELIIGDRQTGKTAVATDTILNQQGKNVICVYVAIGQKASSVAQVVTNFQERGAMEYTIVVAETADSPATLQYLAPYTGAALAEFFMYRERHTSIIYDDLSKQAQAYR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G328690`
TK1151 ID	TkA06G328690
OH-1004 ID	LXL04_007647
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	30.100
Protein coverage (%)	TK1151 61.492 / OH-1004 67.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G328690`
Location	Chr06:82046098-82049569 (+)
Description	Similar to V-type proton ATPase subunit B 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007647` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0007035 vacuolar acidification Biological Process GO:0030835 negative regulation of actin filament depolymerization Biological Process GO:0046034 ATP metabolic process Biological Process GO:0051017 actin filament bundle assembly Biological Process GO:0051693 actin filament capping Biological Process GO:1902600 proton transmembrane transport Biological Process GO:0000221 vacuolar proton-transporting V-type ATPase, V1 domain Cellular Component GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005773 vacuole Cellular Component GO:0005794 Golgi apparatus Cellular Component GO:0005829 cytosol Cellular Component
KEGG gene cross-reference	ath:AT1G20260 ath:AT4G38510 ghi:107890851 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.413

Rank 1 · TkA06G328690 · TK1151

Mitochondrion0.257

Rank 2 · TkA06G328690 · TK1151

Cytoplasm0.179

Rank 3 · TkA06G328690 · TK1151

Peroxisome0.074

Rank 4 · TkA06G328690 · TK1151

Nucleus0.073

Rank 5 · TkA06G328690 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04829PT-VENN4-35 aa

PF00137ATP-synt_C11-47 aa

PF09378HAS-barrel50-86 aa

PF00006ATP-synt_ab83-104 aa

PF06745ATPase137-201 aa

PF00006ATP-synt_ab138-353 aa

PF13191AAA_16149-195 aa

PF09310PD-C2-AF1158-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G328690	`PF04829`	PT-VENN	4	35	8.2	7.4
TkA06G328690	`PF00137`	ATP-synt_C	11	47	9.2e-09	36.1
TkA06G328690	`PF09378`	HAS-barrel	50	86	0.013	16.3
TkA06G328690	`PF00006`	ATP-synt_ab	83	104	3.1e-82	276.1
TkA06G328690	`PF06745`	ATPase	137	201	0.0066	16.6
TkA06G328690	`PF00006`	ATP-synt_ab	138	353	3.1e-82	276.1
TkA06G328690	`PF13191`	AAA_16	149	195	0.23	12.7
TkA06G328690	`PF09310`	PD-C2-AF1	158	231	0.19	11.7
TkA06G328690	`PF00137`	ATP-synt_C	345	359	9.2e-09	36.1
TkA06G328690	`PF09599`	IpaC_SipC	349	489	0.025	15.0
TkA06G328690	`PF23268`	RIN1	357	386	0.28	12.3
TkA06G328690	`PF00306`	ATP-synt_ab_C	360	484	2.1e-44	151.6
TkA06G328690	`PF13191`	AAA_16	398	412	0.23	12.7
TkA06G328690	`PF23268`	RIN1	440	482	0.28	12.3
TkA06G328690	`PF06745`	ATPase	441	471	0.0066	16.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card