TkA06G317950 | RubberDandelionOmics

Gene overview

TkA06G317950

Reference: TK1151 Chr: Chr06 Coordinates: 79611233-79614408 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1283 bp · TkA06G317950|TK1151|cDNA

GAAACGTCAAATTTTCAAATCACGACTCTTAGTCTTCTACTGTATAGATTATCAATTAATGTGTGTTAAAGGGGATGGTTTATGTAATACTAACTTTCCTGAAGTATGATCGGGAGGTCGATTTTCTTAAGGATGTCGATCCATATGGTGCAGAGGGTTAAATTTTTTGGATTTCTTGATGAGCTTTACCGGAATTTCATACTCTTCCACGCTTCATCTTCTTATGGCTGCTGATTTCATCATATACTAATTCCAATTCC...

CDS

Download CDS FASTA

444 bp · TkA06G317950|TK1151|CDS

ATGAAGTTCTGCATGTTTAATGATGACATACAGGGAACTGCTGGTGTTGCATTAGCTGGACTACTTGGAACTGTCAGAGCACAAGGTCTTCCATTGTCAGAGTTTGTAAACCAAAAGATTGTTGTTGTTGGAGTTGGAAGACGGTTGAAAGCTGCGGGACCCGGTGATGTTTGGCAGTCAGAAGGTGCGGATTTGAATAGGAGAACTGGGAACAGGTCTTTTGGTGATATGTTTGGGAACAATTCACCTGATTATCTGCT...

Protein

Download Protein FASTA

147 aa · TkA06G317950|TK1151|PROTEIN

MKFCMFNDDIQGTAGVALAGLLGTVRAQGLPLSEFVNQKIVVVGVGRRLKAAGPGDVWQSEGADLNRRTGNRSFGDMFGNNSPDYLLFKFRALEVALEAACTFLDTQVAELEIEAYPLLDELKSKISTLNLERVRRLKSRLVALTCC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G317950`
TK1151 ID	TkA06G317950
OH-1004 ID	LXL04_012146
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	97.900
Protein coverage (%)	TK1151 31.973 / OH-1004 38.843 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G317950

Location Chr06:79611233-79614408 (+)

Description Similar to NAD-dependent malic enzyme 59 kDa isoform, mitochondrial

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g16010`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`At1g80900`	High-affinity magnesium transporter that mediates the influx of magnesium.	A novel family of magnesium transport genes in Arabidopsis.2001 · DOI: 10.1105/tpc.010352 Overexpression of an Arabidopsis magnesium transport gene, AtMGT1, in Nicotiana benthamiana confers Al tolerance.2006 · DOI: 10.1093/jxb/erl201

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YFN7`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`Os06g0650800`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release
`UniProt: A2XV81`	Magnesium transporter that may mediate the influx of magnesium.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012146 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006108 malate metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005759 mitochondrial matrix Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004471 malate dehydrogenase (decarboxylating) (NAD+) activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0046872 metal ion binding Molecular Function

GO:0050897 cobalt ion binding Molecular Function

GO:0051287 NAD binding Molecular Function

KEGG gene cross-reference

ath:AT2G13560

ath:AT4G00570

sot:102598070

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.355

Rank 1 · TkA06G317950 · TK1151

Nucleus0.179

Rank 2 · TkA06G317950 · TK1151

Mitochondrion0.166

Rank 3 · TkA06G317950 · TK1151

Extracellular0.127

Rank 4 · TkA06G317950 · TK1151

Plastid0.106

Rank 5 · TkA06G317950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03949Malic_M10-47 aa

PF22099MRS2-like82-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G317950	`PF03949`	Malic_M	10	47	1.5e-05	25.1
TkA06G317950	`PF22099`	MRS2-like	82	134	0.022	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S9N4`	Arabidopsis thaliana	sp\|Q9S9N4\|MRS21_ARATH Magnesium transporter MRS2-1	71.200%	Swiss-Prot	High
`Q9SAH0`	Arabidopsis thaliana	sp\|Q9SAH0\|MRS2A_ARATH Magnesium transporter MRS2-10	68.300%	Swiss-Prot	High
`A2YFN7`	Oryza sativa subsp. indica	sp\|A2YFN7\|MRS2B_ORYSI Magnesium transporter MRS2-B	72.300%	Swiss-Prot	Medium
`Q67UQ7`	Oryza sativa subsp. japonica	sp\|Q67UQ7\|MRS2B_ORYSJ Magnesium transporter MRS2-B	72.300%	Swiss-Prot	Medium
`A2XV81`	Oryza sativa subsp. indica	sp\|A2XV81\|MRS2C_ORYSI Magnesium transporter MRS2-C	79.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card