TkA06G314780 | RubberDandelionOmics

Gene overview

TkA06G314780

Reference: TK1151 Chr: Chr06 Coordinates: 78893506-78895965 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1914 bp · TkA06G314780|TK1151|cDNA

TAAGACCCCATGACAAGTTTGTCAAAGTCAAGTTCATATTTCTAACCCAAACAATACGTACATTTCCAACCAAAATTTGACTCCAAATTTAGGAACCAACAGGCCGGCACTCATGCCCCGTTCCTACATTTGTCACTATATACATAATTTGCTAGAAGAACAAGTATTCAAATTTAACAAAAGGAAAGAAAAAAGAGGCGAAAACAAATCTTACAAACAACAATAGTTATTGGAACAGAATATGAAATTCTGGAAGAGGG...

CDS

Download CDS FASTA

1185 bp · TkA06G314780|TK1151|CDS

ATGAAATTCTGGAAGAGGGCTTCTGGAGCACTAAAAGACCGCCAAAGTCTTCTTAAGGCGAGCTTCACTCACCGATCAGCGTTCCGAAATCCAGACATAGAAGCGGCAGTGATTAAAGCGACCAGCCATGACGAATCTCGTGTTAATTACCGGAACGCTCAACGTGTTTTTTCCTGGGTGGTGATTTCCGATGACTATTTACGCCACGTGTTGTGGGCTCTTTCACACAGGATGTGGAGGACCCACGACTGGGTGGTGGT...

Protein

Download Protein FASTA

394 aa · TkA06G314780|TK1151|PROTEIN

MKFWKRASGALKDRQSLLKASFTHRSAFRNPDIEAAVIKATSHDESRVNYRNAQRVFSWVVISDDYLRHVLWALSHRMWRTHDWVVVLKGLMLLHGVFCCKVPGIQEIGRLPFDMMNFKDKRTVRGKLAGLNEFIRAYYAFLDEKSSFIFFHSQEQRDRRVKERIALLSQEEQKENPMIQDLIWLQKLQGLLDLLLQIRPKSKLTVNLLVLEAMDCIVIEFYDICGRICNGIGSVLLTIYPAGGNDAKMALSVLQKAKVQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G314780`
TK1151 ID	TkA06G314780
OH-1004 ID	LXL04_023504
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G314780

Location Chr06:78893506-78895965 (+)

Description Similar to At1g25240: Putative clathrin assembly protein At1g25240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25240`	Putative clathrin assembly protein At1g25240.	No verified direct reference in this release
`At1g68110`	Putative clathrin assembly protein At1g68110.	No verified direct reference in this release
`At2g01920`	Putative clathrin assembly protein At2g01920.	No verified direct reference in this release
`At4g32285`	Probable clathrin assembly protein At4g32285.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023504 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006900 vesicle budding from membrane Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0048268 clathrin coat assembly Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0072583 clathrin-dependent endocytosis Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005905 clathrin-coated pit Cellular Component

KEGG gene cross-reference

ath:AT1G14686

ath:AT1G25240

ath:AT1G68110

ath:AT2G01920

ath:AT4G32285

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.443

Rank 1 · TkA06G314780 · TK1151

Cytoplasm0.389

Rank 2 · TkA06G314780 · TK1151

Nucleus0.267

Rank 3 · TkA06G314780 · TK1151

Endoplasmic reticulum0.058

Rank 4 · TkA06G314780 · TK1151

Golgi apparatus0.057

Rank 5 · TkA06G314780 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07651ANTH32-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G314780	`PF07651`	ANTH	32	301	2.8e-50	171.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FRH3`	Arabidopsis thaliana	sp\|Q9FRH3\|CAP13_ARATH Putative clathrin assembly protein At1g25240	44.500%	Swiss-Prot	Medium
`Q9C9X5`	Arabidopsis thaliana	sp\|Q9C9X5\|CAP12_ARATH Putative clathrin assembly protein At1g68110	42.900%	Swiss-Prot	Medium
`Q9SHV5`	Arabidopsis thaliana	sp\|Q9SHV5\|CAP14_ARATH Putative clathrin assembly protein At2g01920	31.400%	Swiss-Prot	Medium
`Q8S9J8`	Arabidopsis thaliana	sp\|Q8S9J8\|CAP1_ARATH Probable clathrin assembly protein At4g32285	22.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card