TkA06G307740 | RubberDandelionOmics

Gene overview

TkA06G307740

Reference: TK1151 Chr: Chr06 Coordinates: 77285060-77289902 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3466 bp · TkA06G307740|TK1151|cDNA

GGGAAAAACCACGGGCAGCGGAAGCCGAGAACCAATTCACTATATTTTTAGAATGTTACAGAGATTGGATAGAGATTACAAAAGAGAGAGAGCTATATGGTGAAAGGTTTTGTTTTTGGTTATAACAAACCAATTAATTCAGACGATCTTATAAACTGATCGCGATCTATATATATATATAGATCGTCTTGCAACAAAATTCAAAATGTGCAGGTCCCACAGATTGACAAAAGTCTTCTCAATTGTCAAAAAGGAACAAA...

CDS

Download CDS FASTA

903 bp · TkA06G307740|TK1151|CDS

ATGAAAAGTTTTAAGGGAAATGAACAAGCGTCTTCTAGTTTATCAAAGTGGAAATCTGTGTTGAATTCTGTTGCCAAACAAGTCTCTCAGGTGCCTATTTCAATGGCAGTTCGGGTAACAACTCTTAGAGGAACAATACGGGTACACATTAAACCTCCTCCATCCGATCAATTGTGGTTTGGATTCACATCTATGCCTGAAATAGATTTTAGTTTGGAGTCTTCTGTTGGGGACCACAAGATTACAAGTGGACATATTGC...

Protein

Download Protein FASTA

300 aa · TkA06G307740|TK1151|PROTEIN

MKSFKGNEQASSSLSKWKSVLNSVAKQVSQVPISMAVRVTTLRGTIRVHIKPPPSDQLWFGFTSMPEIDFSLESSVGDHKITSGHIALFIISKFKAAIRDTMVLPNSEGVTIPFMLAEKNDWLPQQVAPFLWTNSETATTPTTTTTTTTTIEPTIHESSQEIQPQDVHSTSNRSTESNVSDKPTDDQKSEPNEETISSSHTDEKTPLLEIEEQGQEQADMTVSLRSVQFPSWQHPSPPQQEESNDVAEGEDARLRRMGTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G307740`
TK1151 ID	TkA06G307740
OH-1004 ID	LXL04_035554
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.300
Protein coverage (%)	TK1151 100.000 / OH-1004 39.159 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G307740`
Location	Chr06:77285060-77289902 (-)
Description	Similar to Tex2: Testis-expressed protein 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_035554` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006665 sphingolipid metabolic process Biological Process GO:0006869 lipid transport Biological Process GO:0007165 signal transduction Biological Process GO:0035621 ER to Golgi ceramide transport Biological Process GO:1990854 vacuole-ER tethering Biological Process GO:0005737 cytoplasm Cellular Component GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component GO:0031965 nuclear membrane Cellular Component GO:0033116 endoplasmic reticulum-Golgi intermediate compartment membrane Cellular Component GO:0071561 nucleus-vacuole junction Cellular Component
KEGG gene cross-reference	hsa:55852 mmu:21763 sce:YPR091C spo:2540553 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.347

Rank 1 · TkA06G307740 · TK1151

Cytoplasm0.291

Rank 2 · TkA06G307740 · TK1151

Golgi apparatus0.261

Rank 3 · TkA06G307740 · TK1151

Cell membrane0.175

Rank 4 · TkA06G307740 · TK1151

Nucleus0.132

Rank 5 · TkA06G307740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF26547PDZD8_N34-106 aa

PF05086Dicty_REP134-205 aa

PF10253PRCC135-289 aa

PF29052PGA28-like_dom136-204 aa

PF30130VID28_C165-292 aa

PF17095CAMSAP_CC1272-287 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G307740	`PF26547`	PDZD8_N	34	106	7.8e-09	36.3
TkA06G307740	`PF05086`	Dicty_REP	134	205	0.34	9.6
TkA06G307740	`PF10253`	PRCC	135	289	0.12	13.9
TkA06G307740	`PF29052`	PGA28-like_dom	136	204	0.12	12.7
TkA06G307740	`PF30130`	VID28_C	165	292	1.8	8.0
TkA06G307740	`PF17095`	CAMSAP_CC1	272	287	0.2	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card