TkA06G241980 | RubberDandelionOmics

Gene overview

TkA06G241980

Reference: TK1151 Chr: Chr06 Coordinates: 61945063-61956735 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

992 bp · TkA06G241980|TK1151|cDNA

CGAAACCCTGCTCTTTATTTACCAATTACGAAATTGTGATCGATCGGAGGACCGGATCTCAGAAAATAAATATATGGAAATACTATTCTCAACCTTCACCTCAAACGGAAAACCGGCGAAGATCACGATGATGAATTCTCTCCTCTCTCTAGTACTAGTCTTCTGCGCCGTCTCATCATCGGCAATTGCCGCATCCGATTCTCCTTTCATTGTAGCTCACAAGAAAGCTATACTCAACAGACTCAAATCCGGCGCTGAAA...

CDS

Download CDS FASTA

702 bp · TkA06G241980|TK1151|CDS

ATGGAAATACTATTCTCAACCTTCACCTCAAACGGAAAACCGGCGAAGATCACGATGATGAATTCTCTCCTCTCTCTAGTACTAGTCTTCTGCGCCGTCTCATCATCGGCAATTGCCGCATCCGATTCTCCTTTCATTGTAGCTCACAAGAAAGCTATACTCAACAGACTCAAATCCGGCGCTGAAAAAGTCTCCGTTTCCATCGACATATACAACCAAGGATCTTCGGCCGCTTATGATGTTAGCCTGAGTGATGACAG...

Protein

Download Protein FASTA

233 aa · TkA06G241980|TK1151|PROTEIN

MEILFSTFTSNGKPAKITMMNSLLSLVLVFCAVSSSAIAASDSPFIVAHKKAILNRLKSGAEKVSVSIDIYNQGSSAAYDVSLSDDSWSPEIFSIISGNTSTSWERLDVGSVLSHSFELELTVKSVFYSTPAVITFRVPTKAALQEGYSTPLLPLEILSDKPRENPLDLAATLLGEEDIGQVWVIGIGDIDCCVVCVPGDNSIKERRRKGKQEEALMILINVIFRDTWTNPYV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G241980`
TK1151 ID	TkA06G241980
OH-1004 ID	LXL04_023714
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	76.600
Protein coverage (%)	TK1151 66.094 / OH-1004 78.571 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G241980`
Location	Chr06:61945063-61956735 (+)
Description	Similar to SSR2: Translocon-associated protein subunit beta
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023714` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006613 cotranslational protein targeting to membrane Biological Process GO:0031204 post-translational protein targeting to membrane, translocation Biological Process GO:0005783 endoplasmic reticulum Cellular Component GO:0005789 endoplasmic reticulum membrane Cellular Component GO:0016020 membrane Cellular Component
KEGG gene cross-reference	bta:506530 cfa:403950 hsa:6746 mmu:66256 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.529

Rank 1 · TkA06G241980 · TK1151

Golgi apparatus0.195

Rank 2 · TkA06G241980 · TK1151

Nucleus0.157

Rank 3 · TkA06G241980 · TK1151

Cytoplasm0.107

Rank 4 · TkA06G241980 · TK1151

Lysosome / Vacuole0.070

Rank 5 · TkA06G241980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05753TRAP_beta31-170 aa

PF15571Imm44186-224 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G241980	`PF05753`	TRAP_beta	31	170	7.5e-44	150.0
TkA06G241980	`PF15571`	Imm44	186	224	0.24	12.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card