TkA06G240160 | RubberDandelionOmics

Gene overview

TkA06G240160

Reference: TK1151 Chr: Chr06 Coordinates: 61479621-61480486 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

549 bp · TkA06G240160|TK1151|cDNA

ATGACACCTTATTTCATACTTGTGTTCAGGTATCCACTTGGACGATTGATTGGTGGAACGGTTTACCCTGGATTGACTATAACAGCTAGAACCATATGGAAGGTGCTTCATTTCTTGAATATTCCTCTATCTGTGGAAACTGTTTGTGTATTCACTGCTCCTGTATACTCTGCCTTTGCTGCATGGGAAGTTAAGGGAGCAGGTGCTGGGCTAACAGCTGCAGTTCTCTTCAGTTCTTCTGGCCATGAGGCTGGGAGCTA...

CDS

Download CDS FASTA

324 bp · TkA06G240160|TK1151|CDS

ATGACACCTTATTTCATACTTGTGTTCAGGTATCCACTTGGACGATTGATTGGTGGAACGGTTTACCCTGGATTGACTATAACAGCTAGAACCATATGGAAGGTGCTTCATTTCTTGAATATTCCTCTATCTGTGGAAACTGTTTGTGTATTCACTGCTCCTGTATACTCTGCCTTTGCTGCATGGGAAGTTAAGGGAGCAGGTGCTGGGCTAACAGCTGCAGTTCTCTTCAGTTCTTCTGGCCATGAGGCTGGGAGCTA...

Protein

Download Protein FASTA

107 aa · TkA06G240160|TK1151|PROTEIN

MTPYFILVFRYPLGRLIGGTVYPGLTITARTIWKVLHFLNIPLSVETVCVFTAPVYSAFAAWEVKGAGAGLTAAVLFSSSGHEAGSYDNEAVAFFALIFTFYLYIKL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G240160`
TK1151 ID	TkA06G240160
OH-1004 ID	LXL04_019028
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	78.700
Protein coverage (%)	TK1151 89.720 / OH-1004 13.268 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G240160

Location Chr06:61479621-61480486 (+)

Description Similar to STT3A: Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g19690`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	The STT3a subunit isoform of the Arabidopsis oligosaccharyltransferase controls adaptive responses to salt/osmotic stress.2003 · DOI: 10.1105/tpc.013862 Control of the pattern-recognition receptor EFR by an ER protein complex in plant immunity.2009 · DOI: 10.1038/emboj.2009.262 Receptor quality control in the endoplasmic reticulum for plant innate immunity.2009 · DOI: 10.1038/emboj.2009.263

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0519900`	Catalytic subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019028 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006487 protein N-linked glycosylation Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009651 response to salt stress Biological Process

GO:0043687 post-translational protein modification Biological Process

GO:0047484 regulation of response to osmotic stress Biological Process

GO:0180058 protein co-translational transfer of dolichol-linked oligosaccharide Biological Process

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0008250 oligosaccharyltransferase complex Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G19690

bta:507815

cfa:489300

dosa:Os05g0519900

mmu:16430

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.372

Rank 1 · TkA06G240160 · TK1151

Plastid0.268

Rank 2 · TkA06G240160 · TK1151

Extracellular0.089

Rank 3 · TkA06G240160 · TK1151

Cytoplasm0.088

Rank 4 · TkA06G240160 · TK1151

Nucleus0.034

Rank 5 · TkA06G240160 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02516STT34-106 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G240160	`PF02516`	STT3	4	106	3.1e-12	47.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93ZY3`	Arabidopsis thaliana	sp\|Q93ZY3\|STT3A_ARATH Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A	71.300%	Swiss-Prot	High
`Q6F2Z1`	Oryza sativa subsp. japonica	sp\|Q6F2Z1\|STT3A_ORYSJ Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A	66.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card