TkA06G238320 | RubberDandelionOmics

Gene overview

TkA06G238320

Reference: TK1151 Chr: Chr06 Coordinates: 61093523-61095115 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1154 bp · TkA06G238320|TK1151|cDNA

ATGTGATGCTACAGAAAAAATGTAAATTTCGAACTATTTAAAACCTACTTTTTAATAATTAAACCCCTTTCCCCCGATTTTGCCACCCCAGTCGGCGACCCTTCCCTTCTTCGCCGTCGTCTCCTTTGATGTAACTTTCTGACGGAGTTTTTTTGTGCTCGTCTCTGATATGGTTTTATCCACCATTGATTTCTAACATCGTGACTTGTTCTTCCGGCCTATGCTCTATTTTCCACACCTCATCTCCTTTAACATACGAG...

CDS

Download CDS FASTA

585 bp · TkA06G238320|TK1151|CDS

ATGGAGGAACCACCGTCGTCGGATGGGTCCGTCGTAGATGAATCGGAGATAGAATACGTCAGCTACGCAGGAGAGCATCACTTGCCCCTTATTATGAGCCTAGTCGATGAAGAACTCAGCGAACCCTATTCCATCTTTACCTATCGTTACTTCGTCTATCTCTGGCCCAATCTCTCCTTCCTCGCGTTCCATAAGGGGAAATGCATTGGAACCGTGGTTTCTAAGATGGGAGAACACCGTAATACTTTCCGAGGCTACAT...

Protein

Download Protein FASTA

194 aa · TkA06G238320|TK1151|PROTEIN

MEEPPSSDGSVVDESEIEYVSYAGEHHLPLIMSLVDEELSEPYSIFTYRYFVYLWPNLSFLAFHKGKCIGTVVSKMGEHRNTFRGYIAMLVVIKPYRHKGIATELVTRSIKVMMESGCEEVTLEAEVTNKGALALYGRLGFIRAKRLFRYYLNGVDAFRLKLLFPHPELPPSHPHSHSVISSVLESYAAHELGP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G238320`
TK1151 ID	TkA06G238320
OH-1004 ID	LXL04_023703
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G238320

Location Chr06:61093523-61095115 (-)

Description Similar to MAK3: N-alpha-acetyltransferase MAK3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38130`	Probably required for N-acetylation of some chloroplast precursor proteins and efficient accumulation of thylakoid multiprotein complexes.	Cytoplasmic N-terminal protein acetylation is required for efficient photosynthesis in Arabidopsis.2003 · DOI: 10.1105/tpc.012377

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023703 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:0050821 protein stabilization Biological Process

GO:1904663 regulation of N-terminal peptidyl-methionine acetylation Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0031417 NatC complex Cellular Component

GO:0004596 protein-N-terminal amino-acid acetyltransferase activity Molecular Function

GO:0120518 protein N-terminal-methionine acetyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G38130

dme:Dmel_CG11412

hsa:122830

mmu:70646

xla:779222

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.708

Rank 1 · TkA06G238320 · TK1151

Nucleus0.487

Rank 2 · TkA06G238320 · TK1151

Cell membrane0.062

Rank 3 · TkA06G238320 · TK1151

Lysosome / Vacuole0.048

Rank 4 · TkA06G238320 · TK1151

Endoplasmic reticulum0.038

Rank 5 · TkA06G238320 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13523Acetyltransf_823-38 aa

PF00583Acetyltransf_131-141 aa

PF13673Acetyltransf_1059-147 aa

PF13508Acetyltransf_760-142 aa

PF13420Acetyltransf_460-145 aa

PF13302Acetyltransf_363-141 aa

PF08445FR4782-144 aa

PF13527Acetyltransf_985-141 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G238320	`PF13523`	Acetyltransf_8	23	38	0.002	18.4
TkA06G238320	`PF00583`	Acetyltransf_1	31	141	1.1e-19	71.6
TkA06G238320	`PF13673`	Acetyltransf_10	59	147	8.6e-08	33.0
TkA06G238320	`PF13508`	Acetyltransf_7	60	142	3.1e-09	37.8
TkA06G238320	`PF13420`	Acetyltransf_4	60	145	0.3	11.8
TkA06G238320	`PF13302`	Acetyltransf_3	63	141	0.0003	22.2
TkA06G238320	`PF08445`	FR47	82	144	2.4e-05	25.0
TkA06G238320	`PF13527`	Acetyltransf_9	85	141	0.11	13.2
TkA06G238320	`PF13523`	Acetyltransf_8	92	145	0.002	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O80438`	Arabidopsis thaliana	sp\|O80438\|MAK3_ARATH N-alpha-acetyltransferase MAK3	82.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card