TkA06G237830 | RubberDandelionOmics

Gene overview

TkA06G237830

Reference: TK1151 Chr: Chr06 Coordinates: 60964259-60967456 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1788 bp · TkA06G237830|TK1151|cDNA

TAGTAATAAAGTTAAACTTGGGTGTTAAAAACAAGAAAGGCAGTAGCAACTGTGTGCATACAGTCGTTATTCGTTATCAGTATCAGCAGATAACAACCCTCTCCTCTCCTCAGTGCTCAGTCCTCTCCAGTCTCCACTCTACCTTCAGTCATACATTAAATCCTAAGATTTTCATTTGAATCTTTAACCAAGTGATGATACCCGAAGGTGATGTTTGGATGGAAGGAGGAGGAAACCAAGATGAAATTGAAACATCTTCA...

CDS

Download CDS FASTA

1584 bp · TkA06G237830|TK1151|CDS

ATGATACCCGAAGGTGATGTTTGGATGGAAGGAGGAGGAAACCAAGATGAAATTGAAACATCTTCATGGACGCCGACCATCACCACCACCACCACCGCCGCCACCCACCACCATGTTCTTGGAATTGAAGCTGCTGACACATCATGCAATGACACCACCGCCGCCAATACCTACGCTTCTCTCACCACCTTGAAATCAATGCTTGAAACCGAGTGGTATCACCACAACAATCTCAACCTGTCTTCCAATCCCTCCGATAA...

Protein

Download Protein FASTA

527 aa · TkA06G237830|TK1151|PROTEIN

MIPEGDVWMEGGGNQDEIETSSWTPTITTTTTAATHHHVLGIEAADTSCNDTTAANTYASLTTLKSMLETEWYHHNNLNLSSNPSDNNSIFLPMDSSSSCSPSHSHHPFTLPDPSPSHSYPFFPPKFNNTYDLGFDFGCDPAFLPNHTSNLMNFNGMCSQTHLAIPELSSSSDFPATNNSNDTSDIGGPGFNPPLTAFQSFDGFHGSAPMNPLFAARSKVLRPLEVSPPVGAQPTLFQKRAALRQSSLKLGELGAANWGK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G237830`
TK1151 ID	TkA06G237830
OH-1004 ID	LXL04_023708
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G237830

Location Chr06:60964259-60967456 (+)

Description Similar to SCRM: Transcription factor ICE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g26744`	Transcriptional activator that regulates the cold-induced transcription of CBF/DREB1 genes.	SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1A expression and freezing tolerance in Arabidopsis.2007 · DOI: 10.1105/tpc.106.048397 SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848
`At1g12860`	Mediates stomatal differentiation in the epidermis probably by controlling successive roles of SPCH, MUTE, and FAMA.	SCREAM/ICE1 and SCREAM2 specify three cell-state transitional steps leading to arabidopsis stomatal differentiation.2008 · DOI: 10.1105/tpc.108.060848
`At5g65640`	Transcription factor.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0135700`	Transcription factor involved in defense responses that functions downstream of RAC1 and upstream of PAL1 and WRKY19 genes.	The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity.2012 · DOI: 10.1093/pcp/pcs033
`Os10g0544200`	Probable transcription factor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023708 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0009409 response to cold Biological Process

GO:0009738 abscisic acid-activated signaling pathway Biological Process

GO:0009960 endosperm development Biological Process

GO:0010115 regulation of abscisic acid biosynthetic process Biological Process

GO:0010162 seed dormancy process Biological Process

GO:0010371 regulation of gibberellin biosynthetic process Biological Process

GO:0010440 stomatal lineage progression Biological Process

GO:0010444 guard mother cell differentiation Biological Process

GO:0031347 regulation of defense response Biological Process

KEGG gene cross-reference

ath:AT1G12860

ath:AT3G26744

ath:AT5G10570

ath:AT5G65640

dosa:Os03g0135700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.971

Rank 1 · TkA06G237830 · TK1151

Cytoplasm0.089

Rank 2 · TkA06G237830 · TK1151

Cell membrane0.031

Rank 3 · TkA06G237830 · TK1151

Endoplasmic reticulum0.024

Rank 4 · TkA06G237830 · TK1151

Plastid0.013

Rank 5 · TkA06G237830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00010HLH343-385 aa

PF23177bHLH_IRO3344-396 aa

PF23173bHLH_SAC51345-387 aa

PF22754bHLH-TF_ACT-like_plant444-516 aa

PF26956ACT_ACR_D1461-501 aa

PF23177bHLH_IRO3499-516 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G237830	`PF00010`	HLH	343	385	1e-09	38.8
TkA06G237830	`PF23177`	bHLH_IRO3	344	396	4.3e-06	27.7
TkA06G237830	`PF23173`	bHLH_SAC51	345	387	1.5e-07	32.0
TkA06G237830	`PF22754`	bHLH-TF_ACT-like_plant	444	516	1e-10	42.3
TkA06G237830	`PF26956`	ACT_ACR_D1	461	501	0.018	15.6
TkA06G237830	`PF23177`	bHLH_IRO3	499	516	4.3e-06	27.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LSE2`	Arabidopsis thaliana	sp\|Q9LSE2\|ICE1_ARATH Transcription factor ICE1	58.300%	Swiss-Prot	High
`Q9LPW3`	Arabidopsis thaliana	sp\|Q9LPW3\|SCRM2_ARATH Transcription factor SCREAM2	54.800%	Swiss-Prot	High
`Q9LSL1`	Arabidopsis thaliana	sp\|Q9LSL1\|BH093_ARATH Transcription factor bHLH93	46.500%	Swiss-Prot	Low
`Q10S44`	Oryza sativa subsp. japonica	sp\|Q10S44\|BH003_ORYSJ Transcription factor BHLH3	43.200%	Swiss-Prot	Low
`Q336V8`	Oryza sativa subsp. japonica	sp\|Q336V8\|BH004_ORYSJ Basic helix-loop-helix protein 004	46.800%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card