TkA06G234740 | RubberDandelionOmics

Gene overview

TkA06G234740

Reference: TK1151 Chr: Chr06 Coordinates: 60247732-60250667 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1414 bp · TkA06G234740|TK1151|cDNA

ATGACGAACCATTGTGAATCTGAGATTCTTCTTGCCACTTTACTAGGGACTCGGAAGGTGGAATCGGAGATTTCAAGAACTGGAAGACTGTCGATGAAGGGTTTTGGGGGAGTGAAAGTGGTGTTGCAGGTCATCTCAAACCATTCACTCAGAGAGCAGCCGGGACCGATACCGAAGGGATATGGAATTGAAGCCACACCGTCGCTATCAGACCCACCTAAAATCGCAACACCATCGCAACTACAACTCACCTCCAAATA...

CDS

Download CDS FASTA

645 bp · TkA06G234740|TK1151|CDS

ATGACGAACCATTGTGAATCTGAGATTCTTCTTGCCACTTTACTAGGGACTCGGAAGGTGGAATCGGAGATTTCAAGAACTGGAAGACTGTCGATGAAGGGTTTTGGGGGAGTGAAAGTGGTGTTGCAGGTCATCTCAAACCATTCACTCAGAGAGCAGCCGGGACCGATACCGAAGGGATATGGAATTGAAGCCACACCGTCGCTATCAGACCCACCTAAAATCGCAACACCATCGCAACTACAACTCACCTCCAAATA...

Protein

Download Protein FASTA

214 aa · TkA06G234740|TK1151|PROTEIN

MTNHCESEILLATLLGTRKVESEISRTGRLSMKGFGGVKVVLQVISNHSLREQPGPIPKGYGIEATPSLSDPPKIATPSQLQLTSKYHICHHQRLGLSLLSYGFGAYFNILPGSEWSAIMLTYGFPLTIIGMALLGGGVARRNAPILKKIREEVTGDGKYCLVLVFEAKALELADFEKRQENFTSFFGPGITAEVGKGEEQNMYDVRLISNTTL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G234740`
TK1151 ID	TkA06G234740
OH-1004 ID	LXL04_023730
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.500
Protein coverage (%)	TK1151 90.654 / OH-1004 51.053 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G234740`
Location	Chr06:60247732-60250667 (-)
Description	Similar to At2g40430: Ribosome biogenesis protein NOP53
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_023730` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000027 ribosomal large subunit assembly Biological Process GO:0000460 maturation of 5.8S rRNA Biological Process GO:0006364 rRNA processing Biological Process GO:0010971 positive regulation of G2/M transition of mitotic cell cycle Biological Process GO:0042254 ribosome biogenesis Biological Process GO:0051781 positive regulation of cell division Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005730 nucleolus Cellular Component GO:0008097 5S rRNA binding Molecular Function
KEGG gene cross-reference	ath:AT2G40430 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.324

Rank 1 · TkA06G234740 · TK1151

Cytoplasm0.208

Rank 2 · TkA06G234740 · TK1151

Plastid0.172

Rank 3 · TkA06G234740 · TK1151

Nucleus0.141

Rank 4 · TkA06G234740 · TK1151

Endoplasmic reticulum0.132

Rank 5 · TkA06G234740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11016DUF2854102-134 aa

PF11016DUF2854141-195 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G234740	`PF11016`	DUF2854	102	134	9.4e-19	68.5
TkA06G234740	`PF11016`	DUF2854	141	195	9.4e-19	68.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card