TkA06G233070 | RubberDandelionOmics

Gene overview

TkA06G233070

Reference: TK1151 Chr: Chr06 Coordinates: 59862595-59863959 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1214 bp · TkA06G233070|TK1151|cDNA

CGAATTTGTCAGCGGAGAAAACACGCTGAAGCAACCTGTCCCTACCGATTCCCAACTCTCAATTTCGCATCTCAAACACCCAATTTGCCATTAATTTAAGAGAAGAAAACATTTGTTTAAGCAAAACTATCTTCTTTTTATCAGTTTCTTATCGATCGGCGTTTCAATTTCAACCGTCGAAAGTGGCCGAATCTTCATCAGCATTTGTTCTTGTTCTTGTTCTTGTTCTTGTTCTTCCATCTGATTCGTCGTTATGAACC...

CDS

Download CDS FASTA

555 bp · TkA06G233070|TK1151|CDS

ATGTCCGTAAGAAACTTAATATATGGGGCAACAAGGCGGAGACCGCGGCTACCAACATCTGGAGCAACCATTGATTCAGTGAAAACGGGGCCATCGGTGACCGGATCGGCGTGGGGCAAAGTGAGTTTGACGGCGAAAGCGTTAACGGAAGGTGGGTATGAGTCGCTATACAAACAGAACTTCACGACTTACCCGTACGAGAAACTCAGCCGGACTTTCGCATGTCACTTGTCGACGTCCACCGGACCTGTCGCCGGAAC...

Protein

Download Protein FASTA

184 aa · TkA06G233070|TK1151|PROTEIN

MSVRNLIYGATRRRPRLPTSGATIDSVKTGPSVTGSAWGKVSLTAKALTEGGYESLYKQNFTTYPYEKLSRTFACHLSTSTGPVAGTLYLSNVHVAFCSDRPLSSIQPNGMEAWIHYKVIIPLQKIATVNPITVPSKKQIDKYIQLSTIDGQDFWFMGFVNHDKAAKHLLNGVSNCVKSVPIVP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G233070`
TK1151 ID	TkA06G233070
OH-1004 ID	LXL04_023713
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 86.413 / OH-1004 63.855 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G233070

Location Chr06:59862595-59863959 (-)

Description Similar to At5g13200: GEM-like protein 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g13200`	GEM-like protein 5.	No verified direct reference in this release
`At5g23370`	Putative GEM-like protein 8.	No verified direct reference in this release
`At5g08350`	GEM-like protein 4.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023713 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009637 response to blue light Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0009845 seed germination Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010482 regulation of epidermal cell division Biological Process

GO:0040029 epigenetic regulation of gene expression Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0098755 maintenance of seed dormancy by absisic acid Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G28200

ath:AT2G22475

ath:AT4G40100

ath:AT5G13200

ath:AT5G23350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.409

Rank 1 · TkA06G233070 · TK1151

Cell membrane0.312

Rank 2 · TkA06G233070 · TK1151

Nucleus0.265

Rank 3 · TkA06G233070 · TK1151

Endoplasmic reticulum0.090

Rank 4 · TkA06G233070 · TK1151

Lysosome / Vacuole0.082

Rank 5 · TkA06G233070 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02893GRAM58-170 aa

PF21098PH-GRAM_MTMR6-like82-129 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G233070	`PF02893`	GRAM	58	170	5.8e-14	52.6
TkA06G233070	`PF21098`	PH-GRAM_MTMR6-like	82	129	0.011	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYV6`	Arabidopsis thaliana	sp\|Q9LYV6\|GEML5_ARATH GEM-like protein 5	61.300%	Swiss-Prot	High
`Q9FMW4`	Arabidopsis thaliana	sp\|Q9FMW4\|GEML8_ARATH Putative GEM-like protein 8	42.700%	Swiss-Prot	Medium
`Q9FTA0`	Arabidopsis thaliana	sp\|Q9FTA0\|GEML4_ARATH GEM-like protein 4	42.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card