Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1941 bp · TkA06G230560|TK1151|cDNA
AAAAGATTAAAAACACGTGAATTAATTTGTTGTTGATTTAATCTTAGTCAAAATCGGGCGCGTTGACGAAGGCAATAAATATACCACGTCAACAGTCCTTTTCGGGCAGAAAAAGCCCTATTTGTCGTTTCCTAAATCCTCCTAAGATTTTAATAACCCTTTTTCTTCAACCTTTATCGTTTTCATCACAAATTCAATCTTCAACATCAATACCCTAAAAGGCTAAAACCTTCAGAGATCAGATTATGTCTTGTGTCTGT...
1263 bp · TkA06G230560|TK1151|CDS
ATGTCTTGTGTCTGTGATTTCTGTAATCAGAGATCGGCGGTGTTGTACTGTAAAGCCGATTCGGCTAAGCTCTGTTTGTTCTGTGATAACGCCGTCCACTCTGCTAATGCTTTATCTCTCAAACACTTCCGTTCTCAGATCTGTGACAACTGCGGATCTGATGCCGTTTCCGTCGCCTGTTCAACCGACAATCTTCTCCTCTGCACCTCCTGCGATCACGATTTTCATGGAGACTCCTCCGTTTCCTCTTACCACAATCG...
Protein
Download Protein FASTA420 aa · TkA06G230560|TK1151|PROTEIN
MSCVCDFCNQRSAVLYCKADSAKLCLFCDNAVHSANALSLKHFRSQICDNCGSDAVSVACSTDNLLLCTSCDHDFHGDSSVSSYHNRVPVEEFSGCPSAFQLASIWGFNLKPSGSNGNSCESKYSTSNFQDLATIDEKNPCYDEVPSVDWKSRGSGCGVHNKVLYKQLLELAKEKFDGDGAEMGPQTPNGCGGREVSEGFEYEEQDEKDPLHQQTPLTYLLMPHQNPSNSKANNGGIAEFNNMWSYSPKRETSQIWDFNL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G230560 |
|---|---|
| TK1151 ID | TkA06G230560 |
| OH-1004 ID | LXL04_023724 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 98.100 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G230560 | ||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:59227026-59229545 (-) | ||||||||||||||||||
| Description | Similar to COL15: Zinc finger protein CONSTANS-LIKE 15 | ||||||||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | ||||||||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||||||||
| GO annotations (OH1004 source) | GO:0006355 regulation of DNA-templated transcription Biological Process GO:0007623 circadian rhythm Biological Process GO:0009416 response to light stimulus Biological Process GO:0009637 response to blue light Biological Process GO:0010114 response to red light Biological Process GO:0010218 response to far red light Biological Process GO:0005634 nucleus Cellular Component GO:0000976 transcription cis-regulatory region binding Molecular Function GO:0003677 DNA binding Molecular Function GO:0003700 DNA-binding transcription factor activity Molecular Function GO:0008270 zinc ion binding Molecular Function | ||||||||||||||||||
| KEGG gene cross-reference | ath:AT1G28050 ath:AT2G33500 ath:AT2G47890 ath:AT5G48250 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00643zf-B_box4-42 aaPF22586ANCHR-like_BBOX4-37 aaPF00628PHD5-34 aaPF00643zf-B_box45-90 aaPF22586ANCHR-like_BBOX48-84 aaPF00628PHD48-78 aaPF15524Ntox17227-279 aaPF02045CBFB_NFYA367-418 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G230560 | PF00643 | zf-B_box | 4 | 42 | 1e-09 | 39.1 |
| TkA06G230560 | PF22586 | ANCHR-like_BBOX | 4 | 37 | 0.0019 | 19.0 |
| TkA06G230560 | PF00628 | PHD | 5 | 34 | 9.8 | 7.0 |
| TkA06G230560 | PF00643 | zf-B_box | 45 | 90 | 1e-09 | 39.1 |
| TkA06G230560 | PF22586 | ANCHR-like_BBOX | 48 | 84 | 0.0019 | 19.0 |
| TkA06G230560 | PF00628 | PHD | 48 | 78 | 9.8 | 7.0 |
| TkA06G230560 | PF15524 | Ntox17 | 227 | 279 | 0.091 | 13.6 |
| TkA06G230560 | PF02045 | CBFB_NFYA | 367 | 418 | 0.11 | 13.5 |
| TkA06G230560 | PF06203 | CCT | 376 | 417 | 1.3e-15 | 57.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
| Protein | Organism | Description | Identity | Database | Confidence |
|---|---|---|---|---|---|
O22800 | Arabidopsis thaliana | sp|O22800|COL14_ARATH Zinc finger protein CONSTANS-LIKE 14 | 43.800% | Swiss-Prot | Medium |
Q9C7E8 | Arabidopsis thaliana | sp|Q9C7E8|COL15_ARATH Zinc finger protein CONSTANS-LIKE 15 | 41.700% | Swiss-Prot | Medium |
Q9LUA9 | Arabidopsis thaliana | sp|Q9LUA9|COL10_ARATH Zinc finger protein CONSTANS-LIKE 10 | 31.400% | Swiss-Prot | Medium |
O23379 | Arabidopsis thaliana | sp|O23379|COL11_ARATH Putative zinc finger protein CONSTANS-LIKE 11 | 31.100% | Swiss-Prot | Medium |
O82256 | Arabidopsis thaliana | sp|O82256|COL13_ARATH Zinc finger protein CONSTANS-LIKE 13 | 31.000% | Swiss-Prot | Medium |