TkA06G217830 | RubberDandelionOmics

Gene overview

TkA06G217830

Reference: TK1151 Chr: Chr06 Coordinates: 56288984-56289833 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

636 bp · TkA06G217830|TK1151|cDNA

ATGGCTCCGATGTGTGTGATAGGGTCGCAGTTTATTGCCGATTGCCAGATGGATCTTATAGTTGAACAAAATTCATGTGGAAACCTTTTGATCACAGATATTAACCATAATATCTTGCTCAAAGTGAAACCATGCAACACCTCCTGCCATCGTCAACGAGTGGTACTTGATGTTCATGACAAACCCATCGTAATGATCCGCGAGAAGTTCGTGAGTGGACATAGACGATGGAATGTATTCAGGGGTGATAGTAAAAGCAA...

CDS

Download CDS FASTA

636 bp · TkA06G217830|TK1151|CDS

ATGGCTCCGATGTGTGTGATAGGGTCGCAGTTTATTGCCGATTGCCAGATGGATCTTATAGTTGAACAAAATTCATGTGGAAACCTTTTGATCACAGATATTAACCATAATATCTTGCTCAAAGTGAAACCATGCAACACCTCCTGCCATCGTCAACGAGTGGTACTTGATGTTCATGACAAACCCATCGTAATGATCCGCGAGAAGTTCGTGAGTGGACATAGACGATGGAATGTATTCAGGGGTGATAGTAAAAGCAA...

Protein

Download Protein FASTA

211 aa · TkA06G217830|TK1151|PROTEIN

MAPMCVIGSQFIADCQMDLIVEQNSCGNLLITDINHNILLKVKPCNTSCHRQRVVLDVHDKPIVMIREKFVSGHRRWNVFRGDSKSKSDIIFSTKTSHMIQFKTSVDVFLTNKVGGKNVYDFKIKGSWSNRNCTINMGDTSGTIAQMYKMQSPTENMKFVKGNFMVTIYPGVDYAFVVTLMAIVEAMKTTDKNDEVGAVKVAEIVVGVVLA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G217830`
TK1151 ID	TkA06G217830
OH-1004 ID	LXL04_023805
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 91.469 / OH-1004 99.485 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G217830

Location Chr06:56288984-56289833 (-)

Description Similar to At5g01750: Protein LURP-one-related 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g01750`	Might be related to the phospholipid scramblase and tubby- like superfamily of membrane tethered transcription factors.	Phospholipid scramblases and Tubby-like proteins belong to a new superfamily of membrane tethered transcription factors.2009 · DOI: 10.1093/bioinformatics/btn595
`At3g11740`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release
`At3g16900`	Might be related to the phospholipid scramblase and tubby-like superfamily of membrane tethered transcription factors.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023805 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009751 response to salicylic acid Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0019904 protein domain specific binding Molecular Function

KEGG gene cross-reference

ath:AT1G33840

ath:AT2G14560

ath:AT3G11740

ath:AT3G16900

ath:AT5G01750

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.482

Rank 1 · TkA06G217830 · TK1151

Cell membrane0.320

Rank 2 · TkA06G217830 · TK1151

Nucleus0.320

Rank 3 · TkA06G217830 · TK1151

Endoplasmic reticulum0.065

Rank 4 · TkA06G217830 · TK1151

Lysosome / Vacuole0.064

Rank 5 · TkA06G217830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04525LOR17-184 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G217830	`PF04525`	LOR	17	184	1.2e-34	121.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZX1`	Arabidopsis thaliana	sp\|Q9LZX1\|LOR15_ARATH Protein LURP-one-related 15	42.200%	Swiss-Prot	Medium
`Q9SF24`	Arabidopsis thaliana	sp\|Q9SF24\|LOR10_ARATH Protein LURP-one-related 10	37.200%	Swiss-Prot	Medium
`Q9LSQ1`	Arabidopsis thaliana	sp\|Q9LSQ1\|LOR13_ARATH Protein LURP-one-related 13	36.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card