TkA06G213130 | RubberDandelionOmics

Gene overview

TkA06G213130

Reference: TK1151 Chr: Chr06 Coordinates: 55188149-55188707 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

315 bp · TkA06G213130|TK1151|cDNA

ATGATGGCAATTCTCAAACATGATACCTCAGAACCAGTGAGGAGACGGCAATACACATTACTTCTAAGTTACTTCCAGTACTGTCAGCACATACTGGACCCACACGTTCCTACTACTATTCTTCAATCTTTGTTAGTGGAAGAGCAAGAGAGTGGAGACTTGGATCTCGAGAAGGATCAGGCTGAGCTGGCACGTGCAAACTTATCTATCCTAAGAAAAGAAGCTCAGTATATTCTATATATGACGATTAAAGATGCAAC...

CDS

Download CDS FASTA

315 bp · TkA06G213130|TK1151|CDS

ATGATGGCAATTCTCAAACATGATACCTCAGAACCAGTGAGGAGACGGCAATACACATTACTTCTAAGTTACTTCCAGTACTGTCAGCACATACTGGACCCACACGTTCCTACTACTATTCTTCAATCTTTGTTAGTGGAAGAGCAAGAGAGTGGAGACTTGGATCTCGAGAAGGATCAGGCTGAGCTGGCACGTGCAAACTTATCTATCCTAAGAAAAGAAGCTCAGTATATTCTATATATGACGATTAAAGATGCAAC...

Protein

Download Protein FASTA

104 aa · TkA06G213130|TK1151|PROTEIN

MMAILKHDTSEPVRRRQYTLLLSYFQYCQHILDPHVPTTILQSLLVEEQESGDLDLEKDQAELARANLSILRKEAQYILYMTIKDATQGSESGRIMALFVLDVS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G213130`
TK1151 ID	TkA06G213130
OH-1004 ID	LXL04_023825
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 100.000 / OH-1004 40.226 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G213130

Location Chr06:55188149-55188707 (+)

Description Similar to NUP205: Nuclear pore complex protein NUP205

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g51200`	Nuclear pore complex protein NUP205.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023825 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009617 response to bacterium Biological Process

GO:0009682 induced systemic resistance Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0015031 protein transport Biological Process

GO:0032922 circadian regulation of gene expression Biological Process

GO:0051028 mRNA transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005635 nuclear envelope Cellular Component

GO:0005643 nuclear pore Cellular Component

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.691

Rank 1 · TkA06G213130 · TK1151

Cytoplasm0.416

Rank 2 · TkA06G213130 · TK1151

Mitochondrion0.035

Rank 3 · TkA06G213130 · TK1151

Golgi apparatus0.029

Rank 4 · TkA06G213130 · TK1151

Cell membrane0.029

Rank 5 · TkA06G213130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11894Nup1923-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G213130	`PF11894`	Nup192	3	102	0.0016	16.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KBW6`	Arabidopsis thaliana	sp\|F4KBW6\|NU205_ARATH Nuclear pore complex protein NUP205	58.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card