TkA06G169900 | RubberDandelionOmics

Gene overview

TkA06G169900

Reference: TK1151 Chr: Chr06 Coordinates: 44657992-44659814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1155 bp · TkA06G169900|TK1151|cDNA

ATGATCTTTGAGTTGAATCGACTTTCATTCGAGGTATGGTCTCTAATCGATTGTGAGTTCAAATCAGTGATTTTGATTTTCAAAATAGTCGATATGATGAAGTTGATGCATTATCGGAATCCTTGTCCCGAAGGACTTATCAAATTGGTATCAGAGCAATTCGATTCTGGTGTCAACATGGTAAGCAATTCTGATCGTATCACATTACTGGAGGCGGATTTGGCCAAATTCCGACAAGACATTGAAGGTAATAAGGAGGT...

CDS

Download CDS FASTA

1155 bp · TkA06G169900|TK1151|CDS

ATGATCTTTGAGTTGAATCGACTTTCATTCGAGGTATGGTCTCTAATCGATTGTGAGTTCAAATCAGTGATTTTGATTTTCAAAATAGTCGATATGATGAAGTTGATGCATTATCGGAATCCTTGTCCCGAAGGACTTATCAAATTGGTATCAGAGCAATTCGATTCTGGTGTCAACATGGTAAGCAATTCTGATCGTATCACATTACTGGAGGCGGATTTGGCCAAATTCCGACAAGACATTGAAGGTAATAAGGAGGT...

Protein

Download Protein FASTA

384 aa · TkA06G169900|TK1151|PROTEIN

MIFELNRLSFEVWSLIDCEFKSVILIFKIVDMMKLMHYRNPCPEGLIKLVSEQFDSGVNMVSNSDRITLLEADLAKFRQDIEGNKEVNTLCFEEVMKAITDLSSKVVRLSNKEDDKKSDNNDYSWDEFEESDEESKKKTNDCGKGNSGKRYRNDNKNGDYRKIKMPIFDGNDAHGWIYRAERYFEVQGIEGKEQLKMGAICMEGTALSWYRWEDGRNPFPSWGMLKRKLLERFQPSHEGSIYEHFFAARQEGTARYYVSR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G169900`
TK1151 ID	TkA06G169900
OH-1004 ID	LXL04_022427
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	42.200
Protein coverage (%)	TK1151 57.552 / OH-1004 9.082 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G169900`
Location	Chr06:44657992-44659814 (+)
Description	Similar to THO2: THO complex subunit 2
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_022427` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006397 mRNA processing Biological Process GO:0006406 mRNA export from nucleus Biological Process GO:0008380 RNA splicing Biological Process GO:0035196 miRNA processing Biological Process GO:1990428 miRNA transport Biological Process GO:0000347 THO complex Cellular Component GO:0000445 THO complex part of transcription export complex Cellular Component GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0016607 nuclear speck Cellular Component GO:0003723 RNA binding Molecular Function GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT1G24706 cjc:100399788 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.547

Rank 1 · TkA06G169900 · TK1151

Nucleus0.458

Rank 2 · TkA06G169900 · TK1151

Cell membrane0.069

Rank 3 · TkA06G169900 · TK1151

Mitochondrion0.060

Rank 4 · TkA06G169900 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA06G169900 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF18227LepB_GAP_C86-141 aa

PF03732PEG10_N-capsid116-130 aa

PF19259Ty3_capsid118-131 aa

PF03732PEG10_N-capsid162-234 aa

PF19259Ty3_capsid202-309 aa

PF30901PEG10-RTL1_C-capsid248-312 aa

PF18227LepB_GAP_C291-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G169900	`PF18227`	LepB_GAP_C	86	141	0.15	13.1
TkA06G169900	`PF03732`	PEG10_N-capsid	116	130	1.9e-08	35.2
TkA06G169900	`PF19259`	Ty3_capsid	118	131	0.031	14.4
TkA06G169900	`PF03732`	PEG10_N-capsid	162	234	1.9e-08	35.2
TkA06G169900	`PF19259`	Ty3_capsid	202	309	0.031	14.4
TkA06G169900	`PF30901`	PEG10-RTL1_C-capsid	248	312	0.00069	20.3
TkA06G169900	`PF18227`	LepB_GAP_C	291	312	0.15	13.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card