RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G160840
Reference: TK1151 Chr: Chr06 Coordinates: 42381407-42389389 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1503 bp · TkA06G160840|TK1151|cDNA

ATAAAATCGAATTATGACGTTTTGTGCCTCCGTTTCTTATAAACACGGAAATTATCGGACCACCGCCTGCACTATGAACCGTGTCTTCCGTGTCACCGTGTCACCAACAACAGGTGTACCATGTACATGTCCTCCCTACATTTCAATTTAATTTCTCAAATTTAAATCCTATCTGGCCGGAAATTGGCTAATGGTGAGTTCAGCATCGCCGATTGGCTTCTTTCCGGTTGAACGAAAAACATCTACTCAAGATATGAAGA...

CDS

Download CDS FASTA

1326 bp · TkA06G160840|TK1151|CDS

ATGGTGAGTTCAGCATCGCCGATTGGCTTCTTTCCGGTTGAACGAAAAACATCTACTCAAGATATGAAGAGCACGGACACCGTCGATTCCCTACGTTCTAGGACCACCAATTCCACAAATCCTGCCACTGCCGCGAGGCGCAGAACCGCCGGTAACGTAACGCCGGCGAAAACCTCCCCTAATTTATGTCGGTCACAATCGTTCAGTCGCGAGATCGGACATGCTGCTAGTGAAACGTATTTGATTTCTCGCCTTGCGTT...

Protein

Download Protein FASTA

441 aa · TkA06G160840|TK1151|PROTEIN

MVSSASPIGFFPVERKTSTQDMKSTDTVDSLRSRTTNSTNPATAARRRTAGNVTPAKTSPNLCRSQSFSREIGHAASETYLISRLAFTLLRYLGVGRRWISRLLALGLYAMLLMPGFLQVLHQYFFSPQIRRSIVYGDQPRNRLDLYLPKNIDSPKPVIVFVTGGAWIIGYKGWGSLLGFQLAERDIIVTCLDYRNFPQGTISDMVDDVSRGISFICNNIANYGGDPNRIYLMGQSAGAHISSCVLLKQAIMESKGDPTS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G160840
TK1151 IDTkA06G160840
OH-1004 IDLXL04_024237
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)98.600
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G160840
LocationChr06:42381407-42389389 (-)
DescriptionSimilar to ICMEL2: Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL2
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At3g02410 Catalyzes the demethylation of isoprenylcysteine methylesters (By similarity).
Characterization, sub-cellular localization and expression profiling of the isoprenylcysteine methylesterase gene family in Arabidopsis thaliana.2010 · DOI: 10.1186/1471-2229-10-212
At5g15860 Catalyzes the demethylation of isoprenylcysteine methylesters.
Prenylcysteine methylesterase in Arabidopsis thaliana.2006 · DOI: 10.1016/j.gene.2006.05.023
Isoprenylcysteine methylation and demethylation regulate abscisic acid signaling in Arabidopsis.2008 · DOI: 10.1105/tpc.107.053389
Characterization, sub-cellular localization and expression profiling of the isoprenylcysteine methylesterase gene family in Arabidopsis thaliana.2010 · DOI: 10.1186/1471-2229-10-212
At1g26120 Catalyzes the demethylation of isoprenylcysteine methylesters (By similarity). No verified direct reference in this release

Rice

Reference gene IDPossible functionPapers / DOI
Os06g0708100 Catalyzes the demethylation of isoprenylcysteine methylesters. No verified direct reference in this release
Os05g0577200 Catalyzes the demethylation of isoprenylcysteine methylesters. No verified direct reference in this release
Os01g0642000 Catalyzes the demethylation of isoprenylcysteine methylesters. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_024237 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0009737 response to abscisic acid Biological Process
GO:0000139 Golgi membrane Cellular Component
GO:0005576 extracellular region Cellular Component
GO:0005789 endoplasmic reticulum membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0016020 membrane Cellular Component
GO:0010296 prenylcysteine methylesterase activity Molecular Function
KEGG gene cross-reference
ath:AT1G26120
ath:AT3G02410
ath:AT5G15860
dosa:Os05g0577200
dosa:Os06g0708100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.323
Rank 1 · TkA06G160840 · TK1151
Golgi apparatus0.215
Rank 2 · TkA06G160840 · TK1151
Cytoplasm0.165
Rank 3 · TkA06G160840 · TK1151
Lysosome / Vacuole0.149
Rank 4 · TkA06G160840 · TK1151
Cell membrane0.147
Rank 5 · TkA06G160840 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20434BD-FAE144-351 aa
PF00135COesterase144-248 aa
PF12146Hydrolase_4155-249 aa
PF07859Abhydrolase_3159-368 aa
PF12697Abhydrolase_6159-372 aa
PF02230Abhydrolase_2207-244 aa
PF00326Peptidase_S9222-248 aa
PF02230Abhydrolase_2321-369 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G160840PF20434BD-FAE1443511.8e-2590.4
TkA06G160840PF00135COesterase1442486.8e-1349.1
TkA06G160840PF12146Hydrolase_41552493.8e-0523.8
TkA06G160840PF07859Abhydrolase_31593681.1e-1248.9
TkA06G160840PF12697Abhydrolase_61593720.001320.2
TkA06G160840PF02230Abhydrolase_22072440.08713.4
TkA06G160840PF00326Peptidase_S92222481.4e-0732.0
TkA06G160840PF02230Abhydrolase_23213690.08713.4
TkA06G160840PF00326Peptidase_S93243691.4e-0732.0
TkA06G160840PF12146Hydrolase_43283693.8e-0523.8
TkA06G160840PF01738DLH3283690.03814.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q1PET6Arabidopsis thalianasp|Q1PET6|ICML2_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL270.100%Swiss-ProtHigh
Q94AS5Arabidopsis thalianasp|Q94AS5|ICME_ARATH Isoprenylcysteine alpha-carbonyl methylesterase ICME69.500%Swiss-ProtHigh
Q8VYP9Arabidopsis thalianasp|Q8VYP9|ICML1_ARATH Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL165.300%Swiss-ProtHigh
Q5Z9I2Oryza sativa subsp. japonicasp|Q5Z9I2|IMCL1_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL162.900%Swiss-ProtHigh
Q6L5F5Oryza sativa subsp. japonicasp|Q6L5F5|IMCE_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICME62.400%Swiss-ProtHigh
Q5VNW5Oryza sativa subsp. japonicasp|Q5VNW5|IMCL2_ORYSJ Probable isoprenylcysteine alpha-carbonyl methylesterase ICMEL267.800%Swiss-ProtHigh

JBrowse

View in Genome Browser