TkA06G156580 | RubberDandelionOmics

Gene overview

TkA06G156580

Reference: TK1151 Chr: Chr06 Coordinates: 41316439-41316989 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · TkA06G156580|TK1151|cDNA

ATGTCTTCTATATTTAGTTTTGCTTCTAGTTTTTTAATAACACTGATTACACAGTATAACAGGAGGACGCCAGTCGAAGCTTGGTTGGATACAGAGTTCTTGCCCTATAATTCTAAAGATGAATCCGAATCTTCCATGTTTTTTGGTCCTGAATTTCTGTCTTTAAAACTATATCAACTATGCTCCGAAGAGGATATGGAGTTAGGGAAAATATTGATTAGACCCGGATCATTATTTTTGAATGACTTAGCCAAGGAAAA...

CDS

Download CDS FASTA

474 bp · TkA06G156580|TK1151|CDS

ATGTCTTCTATATTTAGTTTTGCTTCTAGTTTTTTAATAACACTGATTACACAGTATAACAGGAGGACGCCAGTCGAAGCTTGGTTGGATACAGAGTTCTTGCCCTATAATTCTAAAGATGAATCCGAATCTTCCATGTTTTTTGGTCCTGAATTTCTGTCTTTAAAACTATATCAACTATGCTCCGAAGAGGATATGGAGTTAGGGAAAATATTGATTAGACCCGGATCATTATTTTTGAATGACTTAGCCAAGGAAAA...

Protein

Download Protein FASTA

157 aa · TkA06G156580|TK1151|PROTEIN

MSSIFSFASSFLITLITQYNRRTPVEAWLDTEFLPYNSKDESESSMFFGPEFLSLKLYQLCSEEDMELGKILIRPGSLFLNDLAKEKQFTEERYGSVKRVFVICDEDRAIKEEFQYWMIENNPVVLVKELNRVDHMPMLSDPKQLSVSLLDIALGNA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G156580`
TK1151 ID	TkA06G156580
OH-1004 ID	LXL04_024288
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	80.300
Protein coverage (%)	TK1151 84.076 / OH-1004 9.324 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G156580

Location Chr06:41316439-41316989 (+)

Description Similar to RE1: Retrovirus-related Pol polyprotein from transposon RE1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23620`	Methylesterase shown to have carboxylesterase activity, methyl indole-3-acetic acid (MeIAA) esterase activity, methyl salicylate (MeSA) esterase activity and methyl jasmonate (MeJA) esterase activity in vitro.	Identification of likely orthologs of tobacco salicylic acid-binding protein 2 and their role in systemic acquired resistance in Arabidopsis thaliana.2008 · DOI: 10.1111/j.1365-313x.2008.03618.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024288 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0009694 jasmonic acid metabolic process Biological Process

GO:0009696 salicylic acid metabolic process Biological Process

GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process

GO:0015074 DNA integration Biological Process

GO:0045087 innate immune response Biological Process

GO:0003676 nucleic acid binding Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

nta:107791137

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.745

Rank 1 · TkA06G156580 · TK1151

Nucleus0.344

Rank 2 · TkA06G156580 · TK1151

Endoplasmic reticulum0.053

Rank 3 · TkA06G156580 · TK1151

Lysosome / Vacuole0.042

Rank 4 · TkA06G156580 · TK1151

Peroxisome0.040

Rank 5 · TkA06G156580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12697Abhydrolase_684-145 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G156580	`PF12697`	Abhydrolase_6	84	145	0.00043	21.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8S8S9`	Arabidopsis thaliana	sp\|Q8S8S9\|MES1_ARATH Methylesterase 1	56.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card