TkA06G150480 | RubberDandelionOmics

Gene overview

TkA06G150480

Reference: TK1151 Chr: Chr06 Coordinates: 39481831-39484450 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1399 bp · TkA06G150480|TK1151|cDNA

AATTCCCCCACCACATAAAACATCACCCTCCTTCCCTTATACCACCGAACCACCACTCAACTAAAACAAATCTTAATATATTTCTGTTTGCGAAGTGTATATCTCCTGGAAATTTCACCAAAATTTCCAGAAAATAAATAAATGATCAGACTAAATGTCTACTCCTCTTTGCTATCATGCCCAGGTCAAAAAGTGAAGGATCGCCGGAGGAATTCGCCGGCGACGTGGCCATGGCAGCAAAAATGGAACCGGAGTTCATC...

CDS

Download CDS FASTA

936 bp · TkA06G150480|TK1151|CDS

ATGATCAGACTAAATGTCTACTCCTCTTTGCTATCATGCCCAGGTCAAAAAGTGAAGGATCGCCGGAGGAATTCGCCGGCGACGTGGCCATGGCAGCAAAAATGGAACCGGAGTTCATCTAGTAGTCAGAGGATGATTACAATTACTGCCATGGCTTGGAAAGACGAGATGGATGGAAGATTTAGCAACTTACCTGGTCAAAGCTGGGAACCTGGATTGGAAATCGAAGTCCCTTTCGAGCAAAGACCGGTGAATGAGTA...

Protein

Download Protein FASTA

311 aa · TkA06G150480|TK1151|PROTEIN

MIRLNVYSSLLSCPGQKVKDRRRNSPATWPWQQKWNRSSSSSQRMITITAMAWKDEMDGRFSNLPGQSWEPGLEIEVPFEQRPVNEYSSLKEGPLYSWGELSPRSFFIRLGGLWLVTFTVLGLPVSAASFNPSTDPLRFLLAAGTGTLFLVSLVVLRIYLGWSYVGDRLLSAVIPYEESGWYDGQMWVKPPEILARDRLLGSYKVKPVIKLLKQTLVGTGVLLVTAVSLIIFATPVEDFIQTTFLNKDNSEITKNNMSRE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G150480`
TK1151 ID	TkA06G150480
OH-1004 ID	LXL04_024377
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G150480

Location Chr06:39481831-39484450 (+)

Description Similar to CGLD27: Protein CONSERVED IN THE GREEN LINEAGE AND DIATOMS 27, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g67370`	Required for growth in low iron conditions.	Systems and trans-system level analysis identifies conserved iron deficiency responses in the plant lineage.2012 · DOI: 10.1105/tpc.112.102491

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024377 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1990641 response to iron ion starvation Biological Process

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

KEGG gene cross-reference

ath:AT5G67370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.977

Rank 1 · TkA06G150480 · TK1151

Mitochondrion0.026

Rank 2 · TkA06G150480 · TK1151

Nucleus0.020

Rank 3 · TkA06G150480 · TK1151

Cytoplasm0.013

Rank 4 · TkA06G150480 · TK1151

Cell membrane0.011

Rank 5 · TkA06G150480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23477zf_Tbcl_274-80 aa

PF06799CGLD27-like76-217 aa

PF23477zf_Tbcl_2284-294 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G150480	`PF23477`	zf_Tbcl_2	74	80	0.65	10.4
TkA06G150480	`PF06799`	CGLD27-like	76	217	2.9e-55	187.0
TkA06G150480	`PF23477`	zf_Tbcl_2	284	294	0.65	10.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FN15`	Arabidopsis thaliana	sp\|Q9FN15\|GLD27_ARATH Protein CONSERVED IN THE GREEN LINEAGE AND DIATOMS 27, chloroplastic	75.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card