TkA06G125950 | RubberDandelionOmics

Gene overview

TkA06G125950

Reference: TK1151 Chr: Chr06 Coordinates: 32955406-32958313 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

807 bp · TkA06G125950|TK1151|cDNA

ATGCTTGAACCATCCGCAACAATCAACATCAAATCCTTCCGTAATCGATCACCATTTCAGCGTCCGCAGTCCAGGATCCGCATCCGCAGCATTCTAAATCCCATCCGCATCCGCAAGATCAAAGCCTGTACCGCAACAAACGAGCGCACACCACCTTCTCGATGTAATGCCACAACCGCATCCGCACCAACTTCAAAATCGATCCGTAGAACTCCGCCCTTCTGCGATTTCGAGGACACAACGAGGCAAGGAGAACGCGA...

CDS

Download CDS FASTA

807 bp · TkA06G125950|TK1151|CDS

ATGCTTGAACCATCCGCAACAATCAACATCAAATCCTTCCGTAATCGATCACCATTTCAGCGTCCGCAGTCCAGGATCCGCATCCGCAGCATTCTAAATCCCATCCGCATCCGCAAGATCAAAGCCTGTACCGCAACAAACGAGCGCACACCACCTTCTCGATGTAATGCCACAACCGCATCCGCACCAACTTCAAAATCGATCCGTAGAACTCCGCCCTTCTGCGATTTCGAGGACACAACGAGGCAAGGAGAACGCGA...

Protein

Download Protein FASTA

268 aa · TkA06G125950|TK1151|PROTEIN

MLEPSATINIKSFRNRSPFQRPQSRIRIRSILNPIRIRKIKACTATNERTPPSRCNATTASAPTSKSIRRTPPFCDFEDTTRQGEREEEKRARRKWRPCRKLDSDGDSPYPEYDLFGLVKRHPVVLRRLHEQLTVVKSKGKCSNFCGRDKSVGSSHEESVGRKDPMTFLFKAMGRAIKKTVMIAELINRRIAGLHQITSIGSAYMTDMWEPLEEGLLPYQLPIPADQVKPLVEYDHEEGLPNIRGRGRGGREKGLPNIFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G125950`
TK1151 ID	TkA06G125950
OH-1004 ID	LXL04_030020
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	70.300
Protein coverage (%)	TK1151 28.358 / OH-1004 32.372 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G125950`
Location	Chr06:32955406-32958313 (+)
Description	Similar to Rpp25l: Ribonuclease P protein subunit p25-like protein
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_030020` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0001682 tRNA 5'-leader removal Biological Process GO:0006364 rRNA processing Biological Process GO:0006417 regulation of translation Biological Process GO:0000172 ribonuclease MRP complex Cellular Component GO:0000781 chromosome, telomeric region Cellular Component GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005655 nucleolar ribonuclease P complex Cellular Component GO:0005737 cytoplasm Cellular Component GO:0030681 multimeric ribonuclease P complex Cellular Component GO:0003677 DNA binding Molecular Function GO:0003723 RNA binding Molecular Function
KEGG gene cross-reference	bta:512203 hsa:138716 mmu:69961 pfa:PF3D7_0814200 rno:315705 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.451

Rank 1 · TkA06G125950 · TK1151

Cytoplasm0.325

Rank 2 · TkA06G125950 · TK1151

Plastid0.151

Rank 3 · TkA06G125950 · TK1151

Mitochondrion0.083

Rank 4 · TkA06G125950 · TK1151

Cell membrane0.053

Rank 5 · TkA06G125950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12328Rpp2082-93 aa

PF12328Rpp20143-189 aa

PF01918Alba169-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G125950	`PF12328`	Rpp20	82	93	0.0059	17.2
TkA06G125950	`PF12328`	Rpp20	143	189	0.0059	17.2
TkA06G125950	`PF01918`	Alba	169	202	8.5e-09	35.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card