TkA06G123260 | RubberDandelionOmics

Gene overview

TkA06G123260

Reference: TK1151 Chr: Chr06 Coordinates: 32107504-32109152 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

620 bp · TkA06G123260|TK1151|cDNA

GGAAGTTTTCTTAGGAGACGTTTTTGGTTCTTAGAATTTGAGGAGATTTAGAAAATGGGTGAAGAAGGACAAGTGATCAGTTGCCACACTATTAATGCCTGGAATCAACAAATTCAAAAGGACAAGAATAGACTGATAGTTGTGGACTTTGCTGCATCATGGTGTGGACCTTGCCGGGCCATTGCTCCATTTGTAGCAGAATTGGCAAAAAAGATGCCACATGTTACCTTCGTTAAAGTTGATATCGATGAAATGAAGGA...

CDS

Download CDS FASTA

354 bp · TkA06G123260|TK1151|CDS

ATGGGTGAAGAAGGACAAGTGATCAGTTGCCACACTATTAATGCCTGGAATCAACAAATTCAAAAGGACAAGAATAGACTGATAGTTGTGGACTTTGCTGCATCATGGTGTGGACCTTGCCGGGCCATTGCTCCATTTGTAGCAGAATTGGCAAAAAAGATGCCACATGTTACCTTCGTTAAAGTTGATATCGATGAAATGAAGGAAATTGCATCAGATTGGGGTGTGGAAGCAATGCCAACATTTTTGTTCCTAAAAGA...

Protein

Download Protein FASTA

117 aa · TkA06G123260|TK1151|PROTEIN

MGEEGQVISCHTINAWNQQIQKDKNRLIVVDFAASWCGPCRAIAPFVAELAKKMPHVTFVKVDIDEMKEIASDWGVEAMPTFLFLKDGKSVAQVVGAKKDELQQTIIKHSGNSSTSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G123260`
TK1151 ID	TkA06G123260
OH-1004 ID	LXL04_024629
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G123260

Location Chr06:32107504-32109152 (+)

Description Similar to Thioredoxin H-type 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g51030`	Thiol-disulfide oxidoreductase involved in the redox regulation of a number of cytosolic enzymes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024629 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0043085 positive regulation of catalytic activity Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0008047 enzyme activator activity Molecular Function

GO:0015035 protein-disulfide reductase activity Molecular Function

GO:0016671 oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor Molecular Function

KEGG gene cross-reference

ath:AT3G51030

nta:107762104

rcu:8266412

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.654

Rank 1 · TkA06G123260 · TK1151

Nucleus0.338

Rank 2 · TkA06G123260 · TK1151

Mitochondrion0.126

Rank 3 · TkA06G123260 · TK1151

Cell membrane0.106

Rank 4 · TkA06G123260 · TK1151

Endoplasmic reticulum0.101

Rank 5 · TkA06G123260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02780Transketolase_C6-62 aa

PF00085Thioredoxin10-107 aa

PF02966DIM112-90 aa

PF02114Phosducin14-96 aa

PF20207PedC-like14-102 aa

PF13728TraF17-95 aa

PF14595Thioredoxin_918-94 aa

PF14581SseB_C18-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G123260	`PF02780`	Transketolase_C	6	62	0.098	13.3
TkA06G123260	`PF00085`	Thioredoxin	10	107	6.8e-31	107.1
TkA06G123260	`PF02966`	DIM1	12	90	0.0056	17.2
TkA06G123260	`PF02114`	Phosducin	14	96	0.02	14.6
TkA06G123260	`PF20207`	PedC-like	14	102	0.031	15.0
TkA06G123260	`PF13728`	TraF	17	95	0.0034	18.0
TkA06G123260	`PF14595`	Thioredoxin_9	18	94	1.1e-06	29.3
TkA06G123260	`PF14581`	SseB_C	18	69	0.047	14.7
TkA06G123260	`PF13098`	Thioredoxin_2	20	101	1.2e-09	39.3
TkA06G123260	`PF26967`	A6-like_Thioredoxin-like_C	20	99	0.002	18.8
TkA06G123260	`PF08534`	Redoxin	21	104	2.7e-05	24.7
TkA06G123260	`PF26981`	Thioredoxin-like_PDI	21	69	0.18	12.4
TkA06G123260	`PF13899`	Thioredoxin_7	23	84	0.0051	17.6
TkA06G123260	`PF00578`	AhpC-TSA	24	101	0.0051	17.5
TkA06G123260	`PF13905`	Thioredoxin_8	25	68	1.1e-06	29.7
TkA06G123260	`PF10589`	NADH_4Fe-4S	35	72	0.14	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P29448`	Arabidopsis thaliana	sp\|P29448\|TRXH1_ARATH Thioredoxin H1	67.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card