TkA06G120490 | RubberDandelionOmics

Gene overview

TkA06G120490

Reference: TK1151 Chr: Chr06 Coordinates: 31441101-31441872 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

624 bp · TkA06G120490|TK1151|cDNA

ATGAATTGCGATCTCCAAATCCCGTCATTCATAACCCTCCCAAATCTAAAAACGCTACATCTGTCTTTAATCACGTTCCCCGATGACGATCTGACACAAAAGCTCTTCGCTGGTTGTTTGGCTCTTGAAGAACTGGTGTTACTCGACTGTGAATGGACGAATTTGAAGAATGTTATGATTTCGAGTTCCAATTTGAAGCGATTAACAATCGACGACTTGCCTTATTTCGGACCTCCGGATGATCCTGGAGGTTCTAAAAT...

CDS

Download CDS FASTA

624 bp · TkA06G120490|TK1151|CDS

ATGAATTGCGATCTCCAAATCCCGTCATTCATAACCCTCCCAAATCTAAAAACGCTACATCTGTCTTTAATCACGTTCCCCGATGACGATCTGACACAAAAGCTCTTCGCTGGTTGTTTGGCTCTTGAAGAACTGGTGTTACTCGACTGTGAATGGACGAATTTGAAGAATGTTATGATTTCGAGTTCCAATTTGAAGCGATTAACAATCGACGACTTGCCTTATTTCGGACCTCCGGATGATCCTGGAGGTTCTAAAAT...

Protein

Download Protein FASTA

207 aa · TkA06G120490|TK1151|PROTEIN

MNCDLQIPSFITLPNLKTLHLSLITFPDDDLTQKLFAGCLALEELVLLDCEWTNLKNVMISSSNLKRLTIDDLPYFGPPDDPGGSKITIDTPNLVLLKYTGFYENILHCWCPIELFHDLQQAAPSPDDPGGCKITIDTPNLVLLKYTGYLSNEILLCGVSELMKVDIRVQGKSFSPDKNVYSHVIKHSSASASPHQLQRQRHKSASF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G120490`
TK1151 ID	TkA06G120490
OH-1004 ID	LXL04_023031
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 89.610 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G120490

Location Chr06:31441101-31441872 (-)

Description Similar to At3g59240: Putative F-box/FBD/LRR-repeat protein At3g59240

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g60040`	F-box/LRR-repeat protein At3g60040.	No verified direct reference in this release
`At4g14096`	F-box/LRR-repeat protein At4g14096.	No verified direct reference in this release
`At5g56410`	Putative FBD-associated F-box protein At5g56410.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_023031 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT3G59170

ath:AT3G59190

ath:AT3G59240

ath:AT3G60040

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.609

Rank 1 · TkA06G120490 · TK1151

Cytoplasm0.400

Rank 2 · TkA06G120490 · TK1151

Endoplasmic reticulum0.061

Rank 3 · TkA06G120490 · TK1151

Cell membrane0.056

Rank 4 · TkA06G120490 · TK1151

Extracellular0.046

Rank 5 · TkA06G120490 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12799LRR_43-22 aa

PF24758LRR_At5g563707-70 aa

PF13855LRR_89-22 aa

PF23622LRR_At1g61320_AtMIF112-71 aa

PF07723LRR_215-39 aa

PF13855LRR_831-68 aa

PF07723LRR_242-54 aa

PF12799LRR_443-64 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G120490	`PF12799`	LRR_4	3	22	0.63	11.1
TkA06G120490	`PF24758`	LRR_At5g56370	7	70	3.3e-06	27.6
TkA06G120490	`PF13855`	LRR_8	9	22	1.5	9.4
TkA06G120490	`PF23622`	LRR_At1g61320_AtMIF1	12	71	5.9e-05	23.3
TkA06G120490	`PF07723`	LRR_2	15	39	0.00011	23.4
TkA06G120490	`PF13855`	LRR_8	31	68	1.5	9.4
TkA06G120490	`PF07723`	LRR_2	42	54	0.00011	23.4
TkA06G120490	`PF12799`	LRR_4	43	64	0.63	11.1
TkA06G120490	`PF07723`	LRR_2	64	71	0.00011	23.4
TkA06G120490	`PF23622`	LRR_At1g61320_AtMIF1	134	170	5.9e-05	23.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GWI2`	Arabidopsis thaliana	sp\|Q8GWI2\|FBL69_ARATH F-box/LRR-repeat protein At3g60040	40.400%	Swiss-Prot	Low
`Q94B46`	Arabidopsis thaliana	sp\|Q94B46\|FBL74_ARATH F-box/LRR-repeat protein At4g14096	38.500%	Swiss-Prot	Low
`Q9FM90`	Arabidopsis thaliana	sp\|Q9FM90\|FBD24_ARATH Putative FBD-associated F-box protein At5g56410	31.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card