TkA06G105130 | RubberDandelionOmics

Gene overview

TkA06G105130

Reference: TK1151 Chr: Chr06 Coordinates: 27825926-27835617 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3234 bp · TkA06G105130|TK1151|cDNA

ATGTTTATCATCGCCATGGAGGGGCTGAATGTTGCCATGAAAACCGCAGTCCAAAAAGATCTCTTTCATGGGGTCCAAATTCCGAGAGATGGGCTCAAGCTATCACACCTTTTCTACGCGGATGACGCTCTCTTTGTCTGTAATTGGGAGAGCCATAATTTTGCTAATCTTGACCGCATCCTCAAGTGTTTCCACGCCACTACCGGGTTAAAAGTAAACTTTCATAAATCAAAGGTATTTGGTATTGGGGTTTCCGATAA...

CDS

Download CDS FASTA

3234 bp · TkA06G105130|TK1151|CDS

ATGTTTATCATCGCCATGGAGGGGCTGAATGTTGCCATGAAAACCGCAGTCCAAAAAGATCTCTTTCATGGGGTCCAAATTCCGAGAGATGGGCTCAAGCTATCACACCTTTTCTACGCGGATGACGCTCTCTTTGTCTGTAATTGGGAGAGCCATAATTTTGCTAATCTTGACCGCATCCTCAAGTGTTTCCACGCCACTACCGGGTTAAAAGTAAACTTTCATAAATCAAAGGTATTTGGTATTGGGGTTTCCGATAA...

Protein

Download Protein FASTA

1077 aa · TkA06G105130|TK1151|PROTEIN

MFIIAMEGLNVAMKTAVQKDLFHGVQIPRDGLKLSHLFYADDALFVCNWESHNFANLDRILKCFHATTGLKVNFHKSKVFGIGVSDNEIASCARILGCNAGLFPFKYLGVPVGANMSLKRNWAPVIEKTQSKLSSWKAKTLSPECQIKNGDGTLFWLDSWTGCGTLAERFPNHFNLEKKKKFSLISERVKSNSFAGIEETALYSGGAFGAAGRARLRGGAGRCKPLFAALPVIAKILVSRLKLVVNSVVDELQSAYKDRN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G105130`
TK1151 ID	TkA06G105130
OH-1004 ID	LXL04_000694
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	47.100
Protein coverage (%)	TK1151 59.424 / OH-1004 29.177 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G105130

Location Chr06:27825926-27835617 (+)

Description Similar to LBD13: LOB domain-containing protein 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`UniProt: P92555`	Uncharacterized mitochondrial protein AtMg01250.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000694 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009965 leaf morphogenesis Biological Process

GO:0010016 shoot system morphogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:1905177 tracheary element differentiation Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001216 DNA-binding transcription activator activity Molecular Function

GO:0003677 DNA binding Molecular Function

GO:0003824 catalytic activity Molecular Function

KEGG gene cross-reference

ath:AT2G30130

ath:AT2G30340

ath:AT2G40470

ath:AT3G27650

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.570

Rank 1 · TkA06G105130 · TK1151

Nucleus0.287

Rank 2 · TkA06G105130 · TK1151

Cell membrane0.119

Rank 3 · TkA06G105130 · TK1151

Endoplasmic reticulum0.060

Rank 4 · TkA06G105130 · TK1151

Plastid0.046

Rank 5 · TkA06G105130 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00078RVT_125-111 aa

PF00078RVT_1233-311 aa

PF11447DUF3201250-294 aa

PF00078RVT_1451-706 aa

PF11447DUF3201500-531 aa

PF13966zf-RVT894-912 aa

PF13966zf-RVT983-1025 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G105130	`PF00078`	RVT_1	25	111	6.6e-42	144.4
TkA06G105130	`PF00078`	RVT_1	233	311	6.6e-42	144.4
TkA06G105130	`PF11447`	DUF3201	250	294	0.24	11.6
TkA06G105130	`PF00078`	RVT_1	451	706	6.6e-42	144.4
TkA06G105130	`PF11447`	DUF3201	500	531	0.24	11.6
TkA06G105130	`PF13966`	zf-RVT	894	912	5.2e-11	43.8
TkA06G105130	`PF13966`	zf-RVT	983	1025	5.2e-11	43.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P92555`	Arabidopsis thaliana	sp\|P92555\|M1250_ARATH Uncharacterized mitochondrial protein AtMg01250	29.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card