TkA06G097440 | RubberDandelionOmics

Gene overview

TkA06G097440

Reference: TK1151 Chr: Chr06 Coordinates: 25954851-25956206 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1122 bp · TkA06G097440|TK1151|cDNA

ATGCTCCCATGGCAGGCCTTTGGTCACATTATTCCATTTCTTGAACTAGCAAAACTCATGGCCGCCAAAGGCCATAAGATTTCATTCATTTCAACTCCTCGAAACATCCACCGCCTTCCTCAAATCCCATCAAACTTAACCCCTTTCATAAACCTCATCAAAATTGAGCTACCAAAAGTTCAAAATCTCCCACAAAACGCCGAATCCACAAAAGATTTACCCTTCAATAAGGTTAATGTTTTTCCGGCAGCAGTGCTTTG...

CDS

Download CDS FASTA

1122 bp · TkA06G097440|TK1151|CDS

ATGCTCCCATGGCAGGCCTTTGGTCACATTATTCCATTTCTTGAACTAGCAAAACTCATGGCCGCCAAAGGCCATAAGATTTCATTCATTTCAACTCCTCGAAACATCCACCGCCTTCCTCAAATCCCATCAAACTTAACCCCTTTCATAAACCTCATCAAAATTGAGCTACCAAAAGTTCAAAATCTCCCACAAAACGCCGAATCCACAAAAGATTTACCCTTCAATAAGGTTAATGTTTTTCCGGCAGCAGTGCTTTG...

Protein

Download Protein FASTA

373 aa · TkA06G097440|TK1151|PROTEIN

MLPWQAFGHIIPFLELAKLMAAKGHKISFISTPRNIHRLPQIPSNLTPFINLIKIELPKVQNLPQNAESTKDLPFNKVNVFPAAVLCLAGPAEVLMYGDNEKPVGQRFMNRPRWVPFETEVKPSLFQINRSLQDLTGDDENINDGYRLGATVHGCDAVIVRSSYDFEPEWLNLLKTIYRKPIIPAGLLPAEVADDHACWGGIREWLDKHEKGTVVYIGFGTETKPNQYELTQLALGLELCKLPFYWVLIDRRGSSDDEVI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G097440`
TK1151 ID	TkA06G097440
OH-1004 ID	LXL04_024895
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	81.100
Protein coverage (%)	TK1151 100.000 / OH-1004 97.059 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G097440

Location Chr06:25954851-25956206 (-)

Description Similar to UGT91A1: UDP-glycosyltransferase 91A1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g22590`	UDP-glycosyltransferase 91A1.	No verified direct reference in this release
`At5g49690`	UDP-glycosyltransferase 91C1.	No verified direct reference in this release
`At5g65550`	UDP-glycosyltransferase 91B1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024895 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008194 UDP-glycosyltransferase activity Molecular Function

GO:0035251 UDP-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT2G22590

ath:AT5G49690

ath:AT5G65550

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.732

Rank 1 · TkA06G097440 · TK1151

Nucleus0.217

Rank 2 · TkA06G097440 · TK1151

Endoplasmic reticulum0.084

Rank 3 · TkA06G097440 · TK1151

Peroxisome0.074

Rank 4 · TkA06G097440 · TK1151

Plastid0.067

Rank 5 · TkA06G097440 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03033Glyco_transf_288-40 aa

PF04101Glyco_tran_28_C273-341 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G097440	`PF03033`	Glyco_transf_28	8	40	0.024	15.4
TkA06G097440	`PF04101`	Glyco_tran_28_C	273	341	0.0086	16.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940V3`	Arabidopsis thaliana	sp\|Q940V3\|U91A1_ARATH UDP-glycosyltransferase 91A1	38.300%	Swiss-Prot	Medium
`Q9LTA3`	Arabidopsis thaliana	sp\|Q9LTA3\|U91C1_ARATH UDP-glycosyltransferase 91C1	35.500%	Swiss-Prot	Medium
`Q9LSM0`	Arabidopsis thaliana	sp\|Q9LSM0\|U91B1_ARATH UDP-glycosyltransferase 91B1	34.100%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card