TkA06G092660 | RubberDandelionOmics

Gene overview

TkA06G092660

Reference: TK1151 Chr: Chr06 Coordinates: 24657186-24659675 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1740 bp · TkA06G092660|TK1151|cDNA

TTCGTTATAAATCTCTTCAATACTAGCACACTGTTCTCTGTAAAAAGTGCATACAGTGGGTCACACCCACAATACAAAACCCACAATCCCATCATACACATAACACATTGCTTCAACAAAGTCCATAATTTTTTAAACAAAAAGTTCCTACGTTCGAGATCCGTACTAAATGGTCTCATCGGACAAGAAATTGGCTAACGTTGTAGGAGGAAAAACGGCGAGAGCTTGTGATAATTGCATAAAAAAGCGTGCTCGGTGGT...

CDS

Download CDS FASTA

1335 bp · TkA06G092660|TK1151|CDS

ATGGTCTCATCGGACAAGAAATTGGCTAACGTTGTAGGAGGAAAAACGGCGAGAGCTTGTGATAATTGCATAAAAAAGCGTGCTCGGTGGTATTGTGCCGCCGATGACGCTTTCTTGTGTCAATCGTGTGACGGTTCCGTTCACTCAGCCAATCCGTTAGCTCGCCGACATGAAAGGGTTCGTCTAAAGGTAGCTTCTTTGAAGCTTTCCTCTCTGGACAAACCAGCACCGCCGCCATGGCACCATGGTTTCACCAAAAA...

Protein

Download Protein FASTA

444 aa · TkA06G092660|TK1151|PROTEIN

MVSSDKKLANVVGGKTARACDNCIKKRARWYCAADDAFLCQSCDGSVHSANPLARRHERVRLKVASLKLSSLDKPAPPPWHHGFTKKPRTPRGGSHHSRNKLASQRTPKSEESGMSFNPLHLVPEIGSDETTAVTSEEQLLYQVPIFDPFAAELCLSGSPNEVATPVKQTEATTPVDADHHHGSKVTFDLNSFNGLILPSDMELAEFAADVESLLGKGLDEESFAMEGLGLLDCRERDSGESLERVKVEEDQMQCETVEN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G092660`
TK1151 ID	TkA06G092660
OH-1004 ID	LXL04_026807
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.500
Protein coverage (%)	TK1151 96.847 / OH-1004 98.529 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G092660

Location Chr06:24657186-24659675 (-)

Description Similar to COL16: Zinc finger protein CONSTANS-LIKE 16

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25440`	Zinc finger protein CONSTANS-LIKE 16.	No verified direct reference in this release
`At1g68520`	Zinc finger protein CONSTANS-LIKE 6.	No verified direct reference in this release
`At1g73870`	Zinc finger protein CONSTANS-LIKE 7.	No verified direct reference in this release
`At1g49130`	Zinc finger protein CONSTANS-LIKE 8.	No verified direct reference in this release
`At5g57180`	Responsible for specific up-regulation of the translocon genes TOC33 and TOC75 in leaves.	CIA2 coordinately up-regulates protein import and synthesis in leaf chloroplasts.2009 · DOI: 10.1104/pp.109.137240

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026807 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009408 response to heat Biological Process

GO:0009641 shade avoidance Biological Process

GO:0010223 secondary shoot formation Biological Process

GO:0045036 protein targeting to chloroplast Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G25440

ath:AT1G49130

ath:AT1G68520

ath:AT1G73870

ath:AT5G57180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.961

Rank 1 · TkA06G092660 · TK1151

Cytoplasm0.103

Rank 2 · TkA06G092660 · TK1151

Cell membrane0.039

Rank 3 · TkA06G092660 · TK1151

Endoplasmic reticulum0.028

Rank 4 · TkA06G092660 · TK1151

Plastid0.013

Rank 5 · TkA06G092660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01412ArfGap9-49 aa

PF00643zf-B_box17-60 aa

PF16366CEBP_ZZ19-58 aa

PF14951DUF450319-68 aa

PF22586ANCHR-like_BBOX20-58 aa

PF09425Jas_motif52-57 aa

PF06203CCT97-106 aa

PF01412ArfGap280-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G092660	`PF01412`	ArfGap	9	49	0.024	15.4
TkA06G092660	`PF00643`	zf-B_box	17	60	2.6e-07	31.4
TkA06G092660	`PF16366`	CEBP_ZZ	19	58	0.055	14.4
TkA06G092660	`PF14951`	DUF4503	19	68	0.47	9.6
TkA06G092660	`PF22586`	ANCHR-like_BBOX	20	58	0.031	15.1
TkA06G092660	`PF09425`	Jas_motif	52	57	0.97	10.0
TkA06G092660	`PF06203`	CCT	97	106	4.8e-17	62.4
TkA06G092660	`PF01412`	ArfGap	280	329	0.024	15.4
TkA06G092660	`PF00643`	zf-B_box	368	372	2.6e-07	31.4
TkA06G092660	`PF06203`	CCT	391	433	4.8e-17	62.4
TkA06G092660	`PF09425`	Jas_motif	397	413	0.97	10.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWD0`	Arabidopsis thaliana	sp\|Q8RWD0\|COL16_ARATH Zinc finger protein CONSTANS-LIKE 16	45.000%	Swiss-Prot	Medium
`Q8LG76`	Arabidopsis thaliana	sp\|Q8LG76\|COL6_ARATH Zinc finger protein CONSTANS-LIKE 6	46.000%	Swiss-Prot	Medium
`Q9C9A9`	Arabidopsis thaliana	sp\|Q9C9A9\|COL7_ARATH Zinc finger protein CONSTANS-LIKE 7	37.700%	Swiss-Prot	Medium
`Q9M9B3`	Arabidopsis thaliana	sp\|Q9M9B3\|COL8_ARATH Zinc finger protein CONSTANS-LIKE 8	31.000%	Swiss-Prot	Medium
`Q9LU68`	Arabidopsis thaliana	sp\|Q9LU68\|CIA2_ARATH Protein CHLOROPLAST IMPORT APPARATUS 2	45.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card