TkA06G089710 | RubberDandelionOmics

Gene overview

TkA06G089710

Reference: TK1151 Chr: Chr06 Coordinates: 23850809-23854140 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2231 bp · TkA06G089710|TK1151|cDNA

TAAATATTTCAGAAATTGAAGCAACGCGTGTTACCCATTTCCGACTCGTCTCATCTTCACGTTAACATCAACCCTGAAAACAAAACCAATCACCATTGATGCAACTGCAAGATTCCTTCTTCACAACACTACAAAATTGTAAATAATATTTTTTTAAAACCCATCAAAACCCCCCATTATTTTCTCGAAACCGTTCACTCAAGCCAGTTAAAATCAAGAATCATATCAATCTGGCTTTTGATTATTGATTCTTAGGTGGG...

CDS

Download CDS FASTA

1290 bp · TkA06G089710|TK1151|CDS

ATGGGATCAAGAGAAGAGAGGCATCAACATCATGATCTTGTCCCATTAGCTGCATTGATCAGTAGAGAGATGAGAAGTGAAAAACTGGAGAAACCAACTGTTCGATATGGATATGCAGCTCAATCAAGAAAAGGCGAAGATTATTTCATGATGAAAAGTGATTGCCAAAGAGTTTCTGGTCATCAATCGTCCAGTTTTTCAGTTTTCGCAATATTCGATGGCCACAATGGAAATGCGGCAGCAATTTACTCACGGGATAA...

Protein

Download Protein FASTA

429 aa · TkA06G089710|TK1151|PROTEIN

MGSREERHQHHDLVPLAALISREMRSEKLEKPTVRYGYAAQSRKGEDYFMMKSDCQRVSGHQSSSFSVFAIFDGHNGNAAAIYSRDNLLNHILSAIPRGLGREEWLQALPRALVAGFVKTDKEFQRKGQTSGTTATFVIVDRWTVTVASVGDSRCILDTQGDAVSVLTVDHRLEENEEERERVTASGGEVGRLSILGGAEIGPLRCWPGGLCLSRSIGDMDVGEFIVPIPYVKQVKLSNAGGRLIIASDGIWDAVSSETA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G089710`
TK1151 ID	TkA06G089710
OH-1004 ID	LXL04_024994
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G089710

Location Chr06:23850809-23854140 (+)

Description Similar to At1g68410: Probable protein phosphatase 2C 15

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g68410`	Probable protein phosphatase 2C 15.	No verified direct reference in this release
`At1g09160`	Probable protein phosphatase 2C 5.	No verified direct reference in this release
`At1g47380`	Probable protein phosphatase 2C 12.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0513100`	Probable protein phosphatase 2C 3.	No verified direct reference in this release
`Os03g0301700`	Probable protein phosphatase 2C 33.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024994 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:1902531 regulation of intracellular signal transduction Biological Process

GO:0005634 nucleus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT1G09160

ath:AT1G47380

ath:AT1G68410

dosa:Os01g0513100

dosa:Os03g0301700

osa:4323983

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.388

Rank 1 · TkA06G089710 · TK1151

Cell membrane0.356

Rank 2 · TkA06G089710 · TK1151

Nucleus0.312

Rank 3 · TkA06G089710 · TK1151

Golgi apparatus0.071

Rank 4 · TkA06G089710 · TK1151

Endoplasmic reticulum0.070

Rank 5 · TkA06G089710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C61-282 aa

PF07228SpoIIE88-165 aa

PF13672PP2C_2103-281 aa

PF07228SpoIIE239-296 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G089710	`PF00481`	PP2C	61	282	1.9e-36	126.8
TkA06G089710	`PF07228`	SpoIIE	88	165	0.0026	18.4
TkA06G089710	`PF13672`	PP2C_2	103	281	0.002	18.5
TkA06G089710	`PF07228`	SpoIIE	239	296	0.0026	18.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M9C6`	Arabidopsis thaliana	sp\|Q9M9C6\|P2C15_ARATH Probable protein phosphatase 2C 15	74.000%	Swiss-Prot	High
`O80492`	Arabidopsis thaliana	sp\|O80492\|P2C05_ARATH Probable protein phosphatase 2C 5	68.000%	Swiss-Prot	High
`Q9FX08`	Arabidopsis thaliana	sp\|Q9FX08\|P2C12_ARATH Probable protein phosphatase 2C 12	59.300%	Swiss-Prot	High
`Q0JMD4`	Oryza sativa subsp. japonica	sp\|Q0JMD4\|P2C03_ORYSJ Probable protein phosphatase 2C 3	78.600%	Swiss-Prot	High
`Q10MN6`	Oryza sativa subsp. japonica	sp\|Q10MN6\|P2C33_ORYSJ Probable protein phosphatase 2C 33	65.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card