TkA06G089550 | RubberDandelionOmics

Gene overview

TkA06G089550

Reference: TK1151 Chr: Chr06 Coordinates: 23816148-23817873 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1344 bp · TkA06G089550|TK1151|cDNA

ATGTCAAGTAATACGTCTACCCGTGAATGTGCCATGGGAGGGAAACATAGGTGTCACCTTCTTGCCATGACTGTCGCAAGAAACATGGCATGTGTGATACTCATGATGGACGTTTCCGAAAAACCATTGACACGCCGGATCAGAGTTCTTGCAGGATCTGTATCCCTCGTCGTGTTCTTTCTTGTCATTTTCATAATCTGGCGTCTATACAAAAGCAACCGTCTTTCCTATTTCTCATCAAAGGAAAAATCTCCTAATGT...

CDS

Download CDS FASTA

1344 bp · TkA06G089550|TK1151|CDS

ATGTCAAGTAATACGTCTACCCGTGAATGTGCCATGGGAGGGAAACATAGGTGTCACCTTCTTGCCATGACTGTCGCAAGAAACATGGCATGTGTGATACTCATGATGGACGTTTCCGAAAAACCATTGACACGCCGGATCAGAGTTCTTGCAGGATCTGTATCCCTCGTCGTGTTCTTTCTTGTCATTTTCATAATCTGGCGTCTATACAAAAGCAACCGTCTTTCCTATTTCTCATCAAAGGAAAAATCTCCTAATGT...

Protein

Download Protein FASTA

447 aa · TkA06G089550|TK1151|PROTEIN

MSSNTSTRECAMGGKHRCHLLAMTVARNMACVILMMDVSEKPLTRRIRVLAGSVSLVVFFLVIFIIWRLYKSNRLSYFSSKEKSPNVEDGSIFSGVSFFSYNELEDATQNFNPSQELGNGGFGAVYYGKLQDGREVAVKRLYEHNYKRVQQFMNEVQILTRLRHPNLVVLYGCTTRQSHELLLVYEYISNGTIYDHLHGNLSNLRLLTWPLRMNVAIETAKALVYLHASEIIHRDVKTTNILLDHSFGAKVADFGVSRIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G089550`
TK1151 ID	TkA06G089550
OH-1004 ID	LXL04_024999
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 91.275 / OH-1004 61.446 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G089550

Location Chr06:23816148-23817873 (+)

Description Similar to LRK10L-1.1: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g25390`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1.	No verified direct reference in this release
`At5g38210`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3.	No verified direct reference in this release
`At1g66880`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4.	No verified direct reference in this release
`At1g18390`	Probable receptor-like serine/threonine-protein kinase involved in abscisic acid (ABA) signaling.	The AtLRK10L1.2, Arabidopsis ortholog of wheat LRK10, is involved in ABA-mediated signaling and drought resistance.2015 · DOI: 10.1007/s00299-014-1724-2
`At2g23450`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_024999 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007166 cell surface receptor signaling pathway Biological Process

GO:0010089 xylem development Biological Process

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G18390

ath:AT1G25390

ath:AT1G66880

ath:AT2G23450

ath:AT5G38210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.672

Rank 1 · TkA06G089550 · TK1151

Cytoplasm0.173

Rank 2 · TkA06G089550 · TK1151

Nucleus0.112

Rank 3 · TkA06G089550 · TK1151

Endoplasmic reticulum0.092

Rank 4 · TkA06G089550 · TK1151

Golgi apparatus0.052

Rank 5 · TkA06G089550 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23629Death_MADD21-53 aa

PF00069Pkinase113-380 aa

PF07714PK_Tyr_Ser-Thr114-380 aa

PF03109ABC1116-160 aa

PF01636APH131-198 aa

PF06293Kdo139-247 aa

PF03109ABC1223-262 aa

PF14531Kinase-like223-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G089550	`PF23629`	Death_MADD	21	53	0.079	13.8
TkA06G089550	`PF00069`	Pkinase	113	380	1e-44	153.6
TkA06G089550	`PF07714`	PK_Tyr_Ser-Thr	114	380	2.5e-45	155.5
TkA06G089550	`PF03109`	ABC1	116	160	6.2e-05	23.0
TkA06G089550	`PF01636`	APH	131	198	0.17	12.3
TkA06G089550	`PF06293`	Kdo	139	247	0.27	11.3
TkA06G089550	`PF03109`	ABC1	223	262	6.2e-05	23.0
TkA06G089550	`PF14531`	Kinase-like	223	304	0.0055	16.7
TkA06G089550	`PF01636`	APH	228	246	0.17	12.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C6K9`	Arabidopsis thaliana	sp\|Q9C6K9\|LRL11_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1	56.300%	Swiss-Prot	High
`Q8VYG0`	Arabidopsis thaliana	sp\|Q8VYG0\|LRL13_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3	59.100%	Swiss-Prot	High
`F4HQ17`	Arabidopsis thaliana	sp\|F4HQ17\|LRL14_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4	61.900%	Swiss-Prot	Medium
`P0C5E2`	Arabidopsis thaliana	sp\|P0C5E2\|LRL12_ARATH LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2	55.000%	Swiss-Prot	High
`Q8RY67`	Arabidopsis thaliana	sp\|Q8RY67\|WAKLO_ARATH Wall-associated receptor kinase-like 14	51.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card