TkA06G080300 | RubberDandelionOmics

Gene overview

TkA06G080300

Reference: TK1151 Chr: Chr06 Coordinates: 21540842-21543490 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1575 bp · TkA06G080300|TK1151|cDNA

ACAAAATATAAAAATTAACATTAGATCAAATCTCTTTTTTAACAAACTTATATGAAGTTATGAACCATAAACAAACTCCTACTATGCTTGGTAAGGGAATGGGAGTCGCACAAACTAGAAATGAATGTTTTTGAGGCGTGGCAGTGGCAGGATCCTCCTCCGGAGATAGAACATGGTGGACCAGAAGGTCTAAGATCTTTGACGTTTGTCCTCTCATACACAACTTGTCTGAGGTGAACCACCTCTCTACAAGTACCATA...

CDS

Download CDS FASTA

1053 bp · TkA06G080300|TK1151|CDS

ATGTTCATCGCCACCACCATTTCCGCTTCCTTTTCCCCAGTGGGGATAGTAAAAACCCCCAATTTCCGAACTCCGCCGGTCGTCGGAGTATGGGCAGAGGTTTTCCCTCGGTTTATGCCCAAAGAAACGGAGAAAATTAAGGACCCGTTTGCTCGAAGATTAGCTTCAAGGATTGAGAGACTGCCGGTGGAGCTTGGCATCTCAAATGCGTGTATTATGAGTAGCTGTGTGAAGCCAAAGATAAAGAACACCGCAAATCC...

Protein

Download Protein FASTA

350 aa · TkA06G080300|TK1151|PROTEIN

MFIATTISASFSPVGIVKTPNFRTPPVVGVWAEVFPRFMPKETEKIKDPFARRLASRIERLPVELGISNACIMSSCVKPKIKNTANPLVLLHGFDSSCLEWRYTQPLLEQAGFETWAIDILGWGFSNLENLPLCNVESKRDHLYQFWKSYIGRPMLLVGPSLGAAVAIDFAVNHPEAVDKLILMDASVYAEGTGSLSRLPRFVAYAGVSVLKSLPLRLYATSLTFNSLPFNTCLDWTRIGRLHCLLPWWEEATVDFMNSG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G080300`
TK1151 ID	TkA06G080300
OH-1004 ID	LXL04_021155
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	68.000
Protein coverage (%)	TK1151 99.143 / OH-1004 99.704 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G080300

Location Chr06:21540842-21543490 (-)

Description Similar to mhpC: 2-hydroxy-6-oxononadienedioate/2-hydroxy-6-oxononatrienedioate hydrolase (Escherichia coli (strain SE11)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g39220`	Hydrolase involved in tocopherol (vitamin E) biosynthesis.	Genome-wide association identifies a missing hydrolase for tocopherol synthesis in plants.2022 · DOI: 10.1073/pnas.2113488119

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_021155 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0010189 vitamin E biosynthetic process Biological Process

GO:0019380 3-phenylpropionate catabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0016787 hydrolase activity Molecular Function

GO:0016788 hydrolase activity, acting on ester bonds Molecular Function

GO:0018771 2-hydroxy-6-oxonona-2,4-dienedioate hydrolase activity Molecular Function

GO:0042803 protein homodimerization activity Molecular Function

GO:0052823 2-hydroxy-6-oxonona-2,4,7-trienedioate hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT5G39220

ecr:ECIAI1_0350

ecx:EcHS_A0413

ecy:ECSE_0374

eum:ECUMN_0392

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.978

Rank 1 · TkA06G080300 · TK1151

Mitochondrion0.029

Rank 2 · TkA06G080300 · TK1151

Cytoplasm0.023

Rank 3 · TkA06G080300 · TK1151

Nucleus0.021

Rank 4 · TkA06G080300 · TK1151

Peroxisome0.017

Rank 5 · TkA06G080300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00561Abhydrolase_186-318 aa

PF12697Abhydrolase_688-323 aa

PF12146Hydrolase_488-204 aa

PF03096Ndr156-192 aa

PF12146Hydrolase_4260-317 aa

PF03096Ndr265-329 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G080300	`PF00561`	Abhydrolase_1	86	318	4.1e-20	73.2
TkA06G080300	`PF12697`	Abhydrolase_6	88	323	7.3e-17	63.4
TkA06G080300	`PF12146`	Hydrolase_4	88	204	6.5e-15	55.8
TkA06G080300	`PF03096`	Ndr	156	192	1.3e-05	24.8
TkA06G080300	`PF12146`	Hydrolase_4	260	317	6.5e-15	55.8
TkA06G080300	`PF03096`	Ndr	265	329	1.3e-05	24.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84JL7`	Arabidopsis thaliana	sp\|Q84JL7\|VTE7_ARATH Alpha/beta hydrolase domain-containing protein VTE7	59.600%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card