TkA06G079470 | RubberDandelionOmics

Gene overview

TkA06G079470

Reference: TK1151 Chr: Chr06 Coordinates: 21308435-21312087 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

846 bp · TkA06G079470|TK1151|cDNA

ATGCACGTGCCAGTAGTTTTCTTCTACCCAAACTACAAAAAAGGCGACACCAACATTCTAAAGCTATCCTTATCAAAGTCTTTAACACAGTTCTACCCTTTCGCCGGTAGGCTATCAGCACCTCCGGCGACTTACATCAACTGCAACGACAAAGGGGTTGACTTCTTGGAAGCTTCTAATGATGGTTTCCTCGATGACTTCGTTCAGAAGAACAAGCAAGATAAAACCATAGACCAGCTCTTTCCTTATGGTCTCAGTTG...

CDS

Download CDS FASTA

846 bp · TkA06G079470|TK1151|CDS

ATGCACGTGCCAGTAGTTTTCTTCTACCCAAACTACAAAAAAGGCGACACCAACATTCTAAAGCTATCCTTATCAAAGTCTTTAACACAGTTCTACCCTTTCGCCGGTAGGCTATCAGCACCTCCGGCGACTTACATCAACTGCAACGACAAAGGGGTTGACTTCTTGGAAGCTTCTAATGATGGTTTCCTCGATGACTTCGTTCAGAAGAACAAGCAAGATAAAACCATAGACCAGCTCTTTCCTTATGGTCTCAGTTG...

Protein

Download Protein FASTA

281 aa · TkA06G079470|TK1151|PROTEIN

MHVPVVFFYPNYKKGDTNILKLSLSKSLTQFYPFAGRLSAPPATYINCNDKGVDFLEASNDGFLDDFVQKNKQDKTIDQLFPYGLSCSARASSPKLLEVQLNHFSGGGAAVALSISHKFVDAGAVINFVNYWSTVTRAITNSGSSDPSNLSVAVSLRKKLAEKSPELAVGNFFTLSISKMQGEIRLNELVAEVKKGKMELEGIRDQQEVVEKLLNTFSTLRGDVYYTSSVCNAPFYEVDFGWGKPLEVTVRIPDVEENTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G079470`
TK1151 ID	TkA06G079470
OH-1004 ID	LXL04_025132
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	75.500
Protein coverage (%)	TK1151 97.509 / OH-1004 39.706 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G079470

Location Chr06:21308435-21312087 (+)

Description Similar to TAT: Tabersonine-19-hydroxy-O-acetyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g15400`	Monitors brassinosteroids (BR) responses and homeostasis, particularly in the root and hypocotyl in darkness.	Genetic evidence for the reduction of brassinosteroid levels by a BAHD acyltransferase-like protein in Arabidopsis.2012 · DOI: 10.1104/pp.112.197202 Overexpression of a putative Arabidopsis BAHD acyltransferase causes dwarfism that can be rescued by brassinosteroid.2012 · DOI: 10.1093/jxb/ers227

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025132 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009753 response to jasmonic acid Biological Process

GO:0035835 indole alkaloid biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016407 acetyltransferase activity Molecular Function

GO:0016746 acyltransferase activity Molecular Function

KEGG gene cross-reference

ag:URS65387

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.670

Rank 1 · TkA06G079470 · TK1151

Nucleus0.293

Rank 2 · TkA06G079470 · TK1151

Endoplasmic reticulum0.114

Rank 3 · TkA06G079470 · TK1151

Cell membrane0.102

Rank 4 · TkA06G079470 · TK1151

Lysosome / Vacuole0.049

Rank 5 · TkA06G079470 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458Transferase2-138 aa

PF02458Transferase142-280 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G079470	`PF02458`	Transferase	2	138	6.7e-44	150.9
TkA06G079470	`PF02458`	Transferase	142	280	6.7e-44	150.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23393`	Arabidopsis thaliana	sp\|O23393\|BIA1_ARATH BAHD acyltransferase BIA1	37.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card