TkA06G078790 | RubberDandelionOmics

Gene overview

TkA06G078790

Reference: TK1151 Chr: Chr06 Coordinates: 21128567-21132410 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2149 bp · TkA06G078790|TK1151|cDNA

GAGGATTTGGCCCTTTTATGGTCGGAATGAGTAATTACCCAACAGTCTAAAGGTGACAGTCCTTTACTACTGTTCCTTGAACCCCTCCCATTTTCTCCAAAGAATACTCCATCTACAGTACTCTCTCACTACAATTGGGAAAACCAGACAAAGATTTGCAGCGGAATTCCATCTTTCCAAGAACACCTCCGTCTCAAAATTCAACGATTTTGTTCAAATTTTCGAGGTCATGATATTGGGAAGCCCAATTTTGAGTAATG...

CDS

Download CDS FASTA

1488 bp · TkA06G078790|TK1151|CDS

ATGAGGAAACATGGGTGGCAACTTCCGTACCATCCTCTTCAGGTGGTAGCTGTTTCCGTGTTTCTGGCATTGGGATTTGCTTTCTATGTGTTCTTCGCCCCTTTTGTCGGCAAAAAACTCTATCAATACATCGTAATGGGAATCTACACTCCTCTAATTATATGTTCATTTGGCCTGTACATTTGGTGCGCTGGTGCCGATCCAGCAGATACAGGAGTTTTCAAATCACGAAAGTACTCTAAACCCACAAACAACAAAAC...

Protein

Download Protein FASTA

495 aa · TkA06G078790|TK1151|PROTEIN

MRKHGWQLPYHPLQVVAVSVFLALGFAFYVFFAPFVGKKLYQYIVMGIYTPLIICSFGLYIWCAGADPADTGVFKSRKYSKPTNNKTGFKKEGSSSIEDRKNYKSETEKDTSSPSCFMALVPCAAMCHHCSSQDQDSISEDGMFYCNLCEVEVYKYSKHCRVCDKCVDRFDHHCRWLNNCIGKKNYLRFFALMVSALLMLILQWSTGIVVLINCILDHKRFNVEIASKLGSSFTLAPYVTVVVVCTILAMIATLPLVQLF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G078790`
TK1151 ID	TkA06G078790
OH-1004 ID	LXL04_025142
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G078790

Location Chr06:21128567-21132410 (-)

Description Similar to PAT22: Probable protein S-acyltransferase 22

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g69420`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At4g15080`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At2g33640`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release
`At3g22180`	Palmitoyl acyltransferase.	No verified direct reference in this release
`At4g01730`	S-acyltransferase involved in protein lipid modification.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025142 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0018345 protein palmitoylation Biological Process

GO:1990918 double-strand break repair involved in meiotic recombination Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005769 early endosome Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0030659 cytoplasmic vesicle membrane Cellular Component

GO:0016417 S-acyltransferase activity Molecular Function

KEGG gene cross-reference

ath:AT1G69420

ath:AT2G33640

ath:AT3G22180

ath:AT4G01730

ath:AT4G15080

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.309

Rank 1 · TkA06G078790 · TK1151

Endoplasmic reticulum0.264

Rank 2 · TkA06G078790 · TK1151

Cytoplasm0.247

Rank 3 · TkA06G078790 · TK1151

Golgi apparatus0.227

Rank 4 · TkA06G078790 · TK1151

Lysosome / Vacuole0.175

Rank 5 · TkA06G078790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12666PrgI14-57 aa

PF01529DHHC18-59 aa

PF12666PrgI110-126 aa

PF01529DHHC116-132 aa

PF01529DHHC144-277 aa

PF00771FHIPEP193-277 aa

PF10954DUF2755195-252 aa

PF12666PrgI244-281 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G078790	`PF12666`	PrgI	14	57	0.13	13.7
TkA06G078790	`PF01529`	DHHC	18	59	7.8e-30	104.4
TkA06G078790	`PF12666`	PrgI	110	126	0.13	13.7
TkA06G078790	`PF01529`	DHHC	116	132	7.8e-30	104.4
TkA06G078790	`PF01529`	DHHC	144	277	7.8e-30	104.4
TkA06G078790	`PF00771`	FHIPEP	193	277	0.42	9.7
TkA06G078790	`PF10954`	DUF2755	195	252	0.22	12.4
TkA06G078790	`PF12666`	PrgI	244	281	0.13	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C533`	Arabidopsis thaliana	sp\|Q9C533\|ZDHC1_ARATH Probable protein S-acyltransferase 22	53.100%	Swiss-Prot	High
`Q8L5Y5`	Arabidopsis thaliana	sp\|Q8L5Y5\|ZDH17_ARATH Probable protein S-acyltransferase 19	37.500%	Swiss-Prot	Medium
`Q6DR03`	Arabidopsis thaliana	sp\|Q6DR03\|ZDHC3_ARATH Protein S-acyltransferase 21	40.200%	Swiss-Prot	Medium
`Q9LIE4`	Arabidopsis thaliana	sp\|Q9LIE4\|ZDHC8_ARATH Probable protein S-acyltransferase 20	31.700%	Swiss-Prot	Medium
`Q9M115`	Arabidopsis thaliana	sp\|Q9M115\|ZDH16_ARATH Protein S-acyltransferase 18	33.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card