TkA06G078560 | RubberDandelionOmics

Gene overview

TkA06G078560

Reference: TK1151 Chr: Chr06 Coordinates: 21074084-21075321 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

862 bp · TkA06G078560|TK1151|cDNA

TAAAAAGGAAATGCAGTTGGCGCTTGTTTATATTTTTCAGAACTTGTTGTTTCTCTACTTTCTCCATCCATAATCCATGATACCCTAAAACCCACACATTCTCGTTCATCTCTCCCAAATTCAAAGAATGGAGCTTGGACTCGCTCTCTTCATCCTAACCTTGCCATGTCTCTTCACCATTGCTCAATCGATTCGTTTTGAGATCGAATCAGGTACAACCAAATGCATCCACGACGAACTCAGAATCAATTTAATGACAG...

CDS

Download CDS FASTA

636 bp · TkA06G078560|TK1151|CDS

ATGGAGCTTGGACTCGCTCTCTTCATCCTAACCTTGCCATGTCTCTTCACCATTGCTCAATCGATTCGTTTTGAGATCGAATCAGGTACAACCAAATGCATCCACGACGAACTCAGAATCAATTTAATGACAGTCGGCAACTACTCCGTAGTTAATCCGAATCAAGGCTATCCCTTACCTGCACATCACAAAATCAGCGTCGCGCTGTATTCAGAGAAGGAAAATCGGTATCATTATGCGGAATTAGTAGAATCGGGACA...

Protein

Download Protein FASTA

211 aa · TkA06G078560|TK1151|PROTEIN

MELGLALFILTLPCLFTIAQSIRFEIESGTTKCIHDELRINLMTVGNYSVVNPNQGYPLPAHHKISVALYSEKENRYHYAELVESGHFALKVEENGAHMLCFMPVDHKPKVNTTVEINWRSGVAAKGWHDVATKDSVDTMESELKKMEETVTLIHEEMFDLREREKEMQEFIKYTNSMMGYLGLVSLFICLSVAGLQLWHLKSFFEKKKMI

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G078560`
TK1151 ID	TkA06G078560
OH-1004 ID	LXL04_025145
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	62.600
Protein coverage (%)	TK1151 100.000 / OH-1004 52.750 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G078560

Location Chr06:21074084-21075321 (+)

Description Similar to At1g26690: Transmembrane emp24 domain-containing protein p24delta9

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g26690`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At1g14010`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At1g69460`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At2g03290`	Involved in vesicular protein trafficking.	No verified direct reference in this release
`At3g29070`	Involved in vesicular protein trafficking.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025145 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006888 endoplasmic reticulum to Golgi vesicle-mediated transport Biological Process

GO:0007030 Golgi organization Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005793 endoplasmic reticulum-Golgi intermediate compartment Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0030134 COPII-coated ER to Golgi transport vesicle Cellular Component

GO:0032580 Golgi cisterna membrane Cellular Component

KEGG gene cross-reference

ath:AT1G14010

ath:AT1G26690

ath:AT1G69460

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.568

Rank 1 · TkA06G078560 · TK1151

Golgi apparatus0.521

Rank 2 · TkA06G078560 · TK1151

Cytoplasm0.113

Rank 3 · TkA06G078560 · TK1151

Cell membrane0.056

Rank 4 · TkA06G078560 · TK1151

Extracellular0.043

Rank 5 · TkA06G078560 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01105EMP24_GP25L22-206 aa

PF20202DUF656460-95 aa

PF06160EzrA128-174 aa

PF20202DUF6564138-159 aa

PF30631DUF8681185-208 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G078560	`PF01105`	EMP24_GP25L	22	206	5.7e-39	134.8
TkA06G078560	`PF20202`	DUF6564	60	95	0.17	12.2
TkA06G078560	`PF06160`	EzrA	128	174	0.027	13.5
TkA06G078560	`PF20202`	DUF6564	138	159	0.17	12.2
TkA06G078560	`PF30631`	DUF8681	185	208	0.13	12.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LQY3`	Arabidopsis thaliana	sp\|Q9LQY3\|P24D9_ARATH Transmembrane emp24 domain-containing protein p24delta9	51.000%	Swiss-Prot	High
`Q8GYG1`	Arabidopsis thaliana	sp\|Q8GYG1\|P24D7_ARATH Transmembrane emp24 domain-containing protein p24delta7	48.500%	Swiss-Prot	Medium
`Q8VY92`	Arabidopsis thaliana	sp\|Q8VY92\|P24DA_ARATH Transmembrane emp24 domain-containing protein p24delta10	49.000%	Swiss-Prot	Medium
`O81045`	Arabidopsis thaliana	sp\|O81045\|P24D8_ARATH Transmembrane emp24 domain-containing protein p24delta8	48.400%	Swiss-Prot	Medium
`Q9LJV9`	Arabidopsis thaliana	sp\|Q9LJV9\|P24DB_ARATH Transmembrane emp24 domain-containing protein p24delta11	47.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card