TkA06G075730 | RubberDandelionOmics

Gene overview

TkA06G075730

Reference: TK1151 Chr: Chr06 Coordinates: 20293711-20296088 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1498 bp · TkA06G075730|TK1151|cDNA

GTCAAACCCAGTTGGCGATCTAAAACAGTATCTATAAGTAACACAGCTTTCAATAAAGATATCAAAAGAACTAATCTTCCATGGCAGCTAGCTCAAATAAGGAGAAATCTATGTTCAGTTTCTTTCAAATTATTGAAGAACATCATGATGATCAAATCCCAGTCTCAAAAACTTCACCACAGGATGCTGAGATTGGTGAAGTTAGAGAAGAGAATCAAAAGCTGAAACATACATTATCTACGGTTTTGAAGGATTATAAA...

CDS

Download CDS FASTA

1311 bp · TkA06G075730|TK1151|CDS

ATGGCAGCTAGCTCAAATAAGGAGAAATCTATGTTCAGTTTCTTTCAAATTATTGAAGAACATCATGATGATCAAATCCCAGTCTCAAAAACTTCACCACAGGATGCTGAGATTGGTGAAGTTAGAGAAGAGAATCAAAAGCTGAAACATACATTATCTACGGTTTTGAAGGATTATAAATCGTTGCAAATGCATTATAACGATTTTTTCCAACAAGAATTTCCTAAAAGTTCTGAAAATTTGGTTACTGATCATCAAGA...

Protein

Download Protein FASTA

436 aa · TkA06G075730|TK1151|PROTEIN

MAASSNKEKSMFSFFQIIEEHHDDQIPVSKTSPQDAEIGEVREENQKLKHTLSTVLKDYKSLQMHYNDFFQQEFPKSSENLVTDHQEGDGNELICLSLGTLSSNKEKDSPKKVNCFGKSKGGDDEQELKLGLGCQFDMNKDENSKNLELPVPTLKSERREDDDLLDQIPLKKARVSVKVVCDTQTMNDGCQWRKYGQKIAKGNPCPRAYYRCTVSSSCPVRKHVQRCAEDRSVLITTYEGTHNHPLSASATAMASTTSAA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G075730`
TK1151 ID	TkA06G075730
OH-1004 ID	LXL04_025201
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G075730

Location Chr06:20293711-20296088 (+)

Description Similar to WRKY72A: WRKY transcription factor 72A

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g15130`	Transcription factor.	No verified direct reference in this release
`At1g18860`	Transcription factor.	No verified direct reference in this release
`At1g69810`	Transcription factor.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025201 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006952 defense response Biological Process

GO:0005634 nucleus Cellular Component

GO:0003700 DNA-binding transcription factor activity Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G69810

ath:AT5G15130

sly:100529133

sly:100529138

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.978

Rank 1 · TkA06G075730 · TK1151

Cytoplasm0.077

Rank 2 · TkA06G075730 · TK1151

Cell membrane0.024

Rank 3 · TkA06G075730 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA06G075730 · TK1151

Plastid0.010

Rank 5 · TkA06G075730 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03106WRKY187-245 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G075730	`PF03106`	WRKY	187	245	3.1e-25	88.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXG8`	Arabidopsis thaliana	sp\|Q9LXG8\|WRK72_ARATH Probable WRKY transcription factor 72	39.700%	Swiss-Prot	Medium
`Q8VWV6`	Arabidopsis thaliana	sp\|Q8VWV6\|WRK61_ARATH Probable WRKY transcription factor 61	36.400%	Swiss-Prot	Medium
`Q9CAR4`	Arabidopsis thaliana	sp\|Q9CAR4\|WRK36_ARATH Probable WRKY transcription factor 36	37.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card