TkA06G071010 | RubberDandelionOmics

Gene overview

TkA06G071010

Reference: TK1151 Chr: Chr06 Coordinates: 19011802-19013327 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

997 bp · TkA06G071010|TK1151|cDNA

AAGGTACTTACCAAGGCCAACCTGTAGCAGTCAAAGTTCTTGATTTTGGTGATACGAAGATCACGGAAGCTTCAATGGCGTTTGTTAAGGAAGATTTCGTAAAAGAAGTTAATGTGTGGCAAACTCTTGATCATCCAAACGTATCCAAGATGATCGGAGCAACCATGTCCATGACGAAAAATTGCCGGCAGAAGACCAAGAAAAAGAATACGGAAAGTAACTTTTGCATCGTATGTGAATATGTAAGAGGAGGCTCCCTA...

CDS

Download CDS FASTA

771 bp · TkA06G071010|TK1151|CDS

ATGGCGTTTGTTAAGGAAGATTTCGTAAAAGAAGTTAATGTGTGGCAAACTCTTGATCATCCAAACGTATCCAAGATGATCGGAGCAACCATGTCCATGACGAAAAATTGCCGGCAGAAGACCAAGAAAAAGAATACGGAAAGTAACTTTTGCATCGTATGTGAATATGTAAGAGGAGGCTCCCTAAGATCTTATCTATCGAAGAACCGACACAAGAAGTTGCCCTTCAGAACTGCCATTCGATTTGCTCTTGATATTGC...

Protein

Download Protein FASTA

256 aa · TkA06G071010|TK1151|PROTEIN

MAFVKEDFVKEVNVWQTLDHPNVSKMIGATMSMTKNCRQKTKKKNTESNFCIVCEYVRGGSLRSYLSKNRHKKLPFRTAIRFALDIARGLSYLHSKKVIHRDVKPENMLIDKQHMTIKLTDFGESIFEPSELLYTTGERGTRGFMAPEVVARKPYGRKCDVYSFGICLWEIYNCDMAYTFNIDNLTPDIYREMRPLISVNCPKSLAHLMERCWDTDPKKRPEMKDVVVLLEEIEKYESFQTVPEDLHGGCFTFFRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G071010`
TK1151 ID	TkA06G071010
OH-1004 ID	LXL04_025263
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.600
Protein coverage (%)	TK1151 100.000 / OH-1004 75.294 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G071010

Location Chr06:19011802-19013327 (-)

Description Similar to HT1: Serine/threonine/tyrosine-protein kinase HT1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g01490`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At5g50000`	Serine/threonine protein kinase that phosphorylates proteins on serine and threonine residues.	Raf-like kinases CBC1 and CBC2 negatively regulate stomatal opening by negatively regulating plasma membrane H + -ATPase phosphorylation in Arabidopsis.2020 · DOI: 10.1039/c9pp00329k
`At1g62400`	Serine/threonine/tyrosine kinase involved in the control of stomatal movement in response to CO(2).	No verified direct reference in this release
`At2g24360`	Serine/threonine protein kinase that phosphorylates proteins on serine, threonine and tyrosine residues.	Genome-wide analysis and experimentation of plant serine/ threonine/tyrosine-specific protein kinases.2006 · DOI: 10.1007/s11103-005-4109-7
`At4g35780`	Serine/threonine protein kinase that specifically phosphorylates chloroplast precursor proteins in the cytosol within the cleavable presequences (transit peptides).	A protein kinase family in Arabidopsis phosphorylates chloroplast precursor proteins.2006 · DOI: 10.1074/jbc.m606580200 The cytosolic kinases STY8, STY17, and STY46 are involved in chloroplast differentiation in Arabidopsis.2011 · DOI: 10.1104/pp.111.182774

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025263 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0001659 temperature homeostasis Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009190 cyclic nucleotide biosynthetic process Biological Process

GO:0009637 response to blue light Biological Process

GO:0010114 response to red light Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0010344 seed oilbody biogenesis Biological Process

GO:0035556 intracellular signal transduction Biological Process

GO:0045995 regulation of embryonic development Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0071244 cellular response to carbon dioxide Biological Process

KEGG gene cross-reference

ath:AT1G62400

ath:AT2G24360

vg:9925489

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.593

Rank 1 · TkA06G071010 · TK1151

Nucleus0.345

Rank 2 · TkA06G071010 · TK1151

Cell membrane0.265

Rank 3 · TkA06G071010 · TK1151

Mitochondrion0.053

Rank 4 · TkA06G071010 · TK1151

Golgi apparatus0.048

Rank 5 · TkA06G071010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr5-228 aa

PF00069Pkinase6-227 aa

PF06293Kdo42-122 aa

PF03109ABC151-125 aa

PF20624DMRT5_DMB63-99 aa

PF14531Kinase-like69-179 aa

PF17667Pkinase_fungal87-154 aa

PF20624DMRT5_DMB127-148 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G071010	`PF07714`	PK_Tyr_Ser-Thr	5	228	2.4e-47	162.1
TkA06G071010	`PF00069`	Pkinase	6	227	1.4e-44	153.2
TkA06G071010	`PF06293`	Kdo	42	122	0.09	12.9
TkA06G071010	`PF03109`	ABC1	51	125	0.023	14.5
TkA06G071010	`PF20624`	DMRT5_DMB	63	99	0.23	12.3
TkA06G071010	`PF14531`	Kinase-like	69	179	0.00032	20.8
TkA06G071010	`PF17667`	Pkinase_fungal	87	154	0.0052	16.3
TkA06G071010	`PF20624`	DMRT5_DMB	127	148	0.23	12.3
TkA06G071010	`PF07449`	HyaE	215	235	0.14	12.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SSA4`	Arabidopsis thaliana	sp\|Q9SSA4\|CBC1_ARATH Serine/threonine-protein kinase 54	50.200%	Swiss-Prot	High
`Q9FGB1`	Arabidopsis thaliana	sp\|Q9FGB1\|CBC2_ARATH Serine/threonine-protein kinase 52	51.200%	Swiss-Prot	High
`Q2MHE4`	Arabidopsis thaliana	sp\|Q2MHE4\|HT1_ARATH Serine/threonine/tyrosine-protein kinase HT1	37.500%	Swiss-Prot	Medium
`Q9ZQ31`	Arabidopsis thaliana	sp\|Q9ZQ31\|STY13_ARATH Serine/threonine-protein kinase STY13	37.000%	Swiss-Prot	Medium
`Q8RWL6`	Arabidopsis thaliana	sp\|Q8RWL6\|STY17_ARATH Serine/threonine-protein kinase STY17	32.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card