TkA06G070950 | RubberDandelionOmics

Gene overview

TkA06G070950

Reference: TK1151 Chr: Chr06 Coordinates: 18991052-18992876 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1441 bp · TkA06G070950|TK1151|cDNA

ATTTTCTAGCATCTATATAAAAACAAAATGAAAAAAATGCACACCATATAAAACGAGGGCAGAGGTAACAGAAGCTATCATGAATCCATCAGTTGGTAGCCAGAAGAAAGTTTGTTGATAATGGAAGCTCTATTGAGCTCCTCCGCAACTCTACCACTCCGGCCGCCGCTTTCTAGCTCCTTTTCATCCAAACCCTCACTTTCTCTCTCTACATTCACACCCCTCGCCACCAAAACCAAAAGAAATTCTCCATTTTCTCG...

CDS

Download CDS FASTA

1206 bp · TkA06G070950|TK1151|CDS

ATGGAAGCTCTATTGAGCTCCTCCGCAACTCTACCACTCCGGCCGCCGCTTTCTAGCTCCTTTTCATCCAAACCCTCACTTTCTCTCTCTACATTCACACCCCTCGCCACCAAAACCAAAAGAAATTCTCCATTTTCTCGCAAAAACTCACAACTGAAAGTGAACCACTGTTTTCGAGTCTGTGCGAGTTCCTCTTCGAGATCTGCAACTGAAACTGCTGTCGATTCTTCAGCTGTGCCCTCTGAGATGAAGGCGTGGGT...

Protein

Download Protein FASTA

401 aa · TkA06G070950|TK1151|PROTEIN

MEALLSSSATLPLRPPLSSSFSSKPSLSLSTFTPLATKTKRNSPFSRKNSQLKVNHCFRVCASSSSRSATETAVDSSAVPSEMKAWVYVEYGGVDVLKFSSNVTVPEVKDDQVLVKVVAAALNPVDFKRRLGKFQATDSALPTVPGYDVAGVVVKVGSLVKGLKVGDEVYGDISEKALDGPKQSGSLAEYTAVEEKLLALKPKNLDFAQAASLPLAIETAYEGLERAGFSKGKSILVLNGAGGVGSLVIQLAKQVFGASK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G070950`
TK1151 ID	TkA06G070950
OH-1004 ID	LXL04_025265
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G070950

Location Chr06:18991052-18992876 (-)

Description Similar to EO: 2-methylene-furan-3-one reductase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g23740`	Reduces the double bond in short-chain unsaturated carbonyls.	NADPH-dependent reductases involved in the detoxification of reactive carbonyls in plants.2011 · DOI: 10.1074/jbc.m110.202226

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025265 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009409 response to cold Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009579 thylakoid Cellular Component

GO:0009941 chloroplast envelope Cellular Component

GO:0010319 stromule Cellular Component

GO:0048046 apoplast Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0035671 enone reductase activity Molecular Function

GO:0035798 2-alkenal reductase (NADPH) activity Molecular Function

GO:0102978 furaneol oxidoreductase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23740

sly:101250690

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.985

Rank 1 · TkA06G070950 · TK1151

Mitochondrion0.027

Rank 2 · TkA06G070950 · TK1151

Cytoplasm0.021

Rank 3 · TkA06G070950 · TK1151

Peroxisome0.020

Rank 4 · TkA06G070950 · TK1151

Cell membrane0.013

Rank 5 · TkA06G070950 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08240ADH_N110-202 aa

PF02254TrkA_N221-282 aa

PF00107ADH_zinc_N243-323 aa

PF13602ADH_zinc_N_2276-387 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G070950	`PF08240`	ADH_N	110	202	1.3e-16	61.4
TkA06G070950	`PF02254`	TrkA_N	221	282	0.075	14.1
TkA06G070950	`PF00107`	ADH_zinc_N	243	323	3.6e-13	50.3
TkA06G070950	`PF13602`	ADH_zinc_N_2	276	387	4.3e-19	70.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZUC1`	Arabidopsis thaliana	sp\|Q9ZUC1\|AOR_ARATH NADPH-dependent alkenal/one oxidoreductase, chloroplastic	77.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card