TkA06G070930 | RubberDandelionOmics

Gene overview

TkA06G070930

Reference: TK1151 Chr: Chr06 Coordinates: 18981235-18984223 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1915 bp · TkA06G070930|TK1151|cDNA

ATATGCTCCGTTACCATTTACCAGCTAATAAATCTGGCTCTCAAACTTGAGTTTGGGAGGGAGAGAAACAAGAGGAATTTTGCAAAAATTCTAGGGTTAGCAAGAGGGGAAAACGATACCCAATTCAACACAGCTGATTCCCCGCCAAACGTCGGTGATTGCTAGTGTCAAGAAGACGAAATGGTGTTGGAAGAAGATCAAGAGCAAGACAAACCTAATGATAATGGGTTGAAATCAACAGACGACGACAACAGGTCAGA...

CDS

Download CDS FASTA

1515 bp · TkA06G070930|TK1151|CDS

ATGGTGTTGGAAGAAGATCAAGAGCAAGACAAACCTAATGATAATGGGTTGAAATCAACAGACGACGACAACAGGTCAGATGAGAAAGGCTTAAGTGATGTCGCTGTTGAAAGCGCAGATGATGCTAATAATGCAGAACACGATGATAAGCCGAGTGCTACTGACCGCGTAGCGAATCAGCCGGATTCGGTTGTAGCAGACGCAAATGAGGATGTTAAGTCCATAGACACAGAAGCAGCAGTTGAGAAACAGGAACAACT...

Protein

Download Protein FASTA

504 aa · TkA06G070930|TK1151|PROTEIN

MVLEEDQEQDKPNDNGLKSTDDDNRSDEKGLSDVAVESADDANNAEHDDKPSATDRVANQPDSVVADANEDVKSIDTEAAVEKQEQLDNGEEDHFSSPSPSPTGSGGNKDDGPEEEEHQIIVKEEKLNPEEVSVAKIEPELLPPEREDEAVDDDEEAELNSVTGVEGSHLASEVVEEEAADFKSLQNQKSFLLEPNSSLEEESGSEEDQAAFMKELEIFHKERCLEFKPPRFYGEPLNCLKLWRSVIRHGGYEQVTSCKV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G070930`
TK1151 ID	TkA06G070930
OH-1004 ID	LXL04_025267
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G070930

Location Chr06:18981235-18984223 (-)

Description Similar to ARID3: AT-rich interactive domain-containing protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17410`	AT-rich interactive domain-containing protein 3.	No verified direct reference in this release
`At1g76510`	AT-rich interactive domain-containing protein 5.	No verified direct reference in this release
`At1g20910`	AT-rich interactive domain-containing protein 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025267 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000741 karyogamy Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009846 pollen germination Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010197 polar nucleus fusion Biological Process

GO:0019760 glucosinolate metabolic process Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0032991 protein-containing complex Cellular Component

GO:0090406 pollen tube Cellular Component

KEGG gene cross-reference

ath:AT1G04880

ath:AT1G20910

ath:AT1G76110

ath:AT1G76510

ath:AT2G17410

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA06G070930 · TK1151

Cytoplasm0.084

Rank 2 · TkA06G070930 · TK1151

Cell membrane0.024

Rank 3 · TkA06G070930 · TK1151

Endoplasmic reticulum0.014

Rank 4 · TkA06G070930 · TK1151

Plastid0.009

Rank 5 · TkA06G070930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00011HSP20114-138 aa

PF01388ARID209-293 aa

PF00011HSP20420-503 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G070930	`PF00011`	HSP20	114	138	4.3e-06	27.5
TkA06G070930	`PF01388`	ARID	209	293	1e-18	68.2
TkA06G070930	`PF00011`	HSP20	420	503	4.3e-06	27.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q940Y3`	Arabidopsis thaliana	sp\|Q940Y3\|ARID3_ARATH AT-rich interactive domain-containing protein 3	62.800%	Swiss-Prot	Medium
`Q0WNR6`	Arabidopsis thaliana	sp\|Q0WNR6\|ARID5_ARATH AT-rich interactive domain-containing protein 5	60.200%	Swiss-Prot	Medium
`C0SUW7`	Arabidopsis thaliana	sp\|C0SUW7\|ARID6_ARATH AT-rich interactive domain-containing protein 6	59.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card