TkA06G063570 | RubberDandelionOmics

Gene overview

TkA06G063570

Reference: TK1151 Chr: Chr06 Coordinates: 17145179-17145802 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA06G063570|TK1151|cDNA

ATGGACATTGTTGGAATTAGCAAAGAAGAACAGGATGCAATTTTTAGGGTTGTAGCTGCGATTCTTCATATTGGCAACATCAATTTTGCAAAAGGAGAGGAGATTGATTCTTCCGTTCTTAAAGATGAGAAATCGAGGTTTCATCTCAATGTCACTGCCGAATTGCTTATGTGTGATGCTAAGAGCTTGGAAGATGCGTTGATTAAGCGTGTAATGGTGACTCCAGAAGAGGTGATTACAAGAACTCTTGATCCTGAAGC...

CDS

Download CDS FASTA

456 bp · TkA06G063570|TK1151|CDS

ATGGACATTGTTGGAATTAGCAAAGAAGAACAGGATGCAATTTTTAGGGTTGTAGCTGCGATTCTTCATATTGGCAACATCAATTTTGCAAAAGGAGAGGAGATTGATTCTTCCGTTCTTAAAGATGAGAAATCGAGGTTTCATCTCAATGTCACTGCCGAATTGCTTATGTGTGATGCTAAGAGCTTGGAAGATGCGTTGATTAAGCGTGTAATGGTGACTCCAGAAGAGGTGATTACAAGAACTCTTGATCCTGAAGC...

Protein

Download Protein FASTA

151 aa · TkA06G063570|TK1151|PROTEIN

MDIVGISKEEQDAIFRVVAAILHIGNINFAKGEEIDSSVLKDEKSRFHLNVTAELLMCDAKSLEDALIKRVMVTPEEVITRTLDPEAALGSRDALAKTVYSRLFDWIVEKIHNSIGQDPNSKSLIGVLDIYGFESFKHNRYCVRNLKSIRF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G063570`
TK1151 ID	TkA06G063570
OH-1004 ID	LXL04_022189
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.200
Protein coverage (%)	TK1151 93.377 / OH-1004 9.010 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G063570

Location Chr06:17145179-17145802 (-)

Description Similar to XI-E: Myosin-11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g20490`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g17580`	Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.	Enzymatic activity and motility of recombinant Arabidopsis myosin XI, MYA1.2007 · DOI: 10.1093/pcp/pcm054 A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.2009 · DOI: 10.1104/pp.109.136853 Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.2012 · DOI: 10.1093/jxb/err265
`At1g08730`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g54560`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At1g04160`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022189 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0009860 pollen tube growth Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0010091 trichome branching Biological Process

GO:0010154 fruit development Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0051301 cell division Biological Process

KEGG gene cross-reference

ath:AT1G04160

ath:AT1G08730

ath:AT1G17580

ath:AT1G54560

ath:AT5G20490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.706

Rank 1 · TkA06G063570 · TK1151

Nucleus0.183

Rank 2 · TkA06G063570 · TK1151

Cell membrane0.130

Rank 3 · TkA06G063570 · TK1151

Golgi apparatus0.070

Rank 4 · TkA06G063570 · TK1151

Lysosome / Vacuole0.064

Rank 5 · TkA06G063570 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00063Myosin_head1-140 aa

PF03524CagX11-62 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G063570	`PF00063`	Myosin_head	1	140	6.2e-39	134.5
TkA06G063570	`PF03524`	CagX	11	62	0.041	14.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4K5J1`	Arabidopsis thaliana	sp\|F4K5J1\|MYO17_ARATH Myosin-17	84.400%	Swiss-Prot	High
`Q39160`	Arabidopsis thaliana	sp\|Q39160\|MYO5_ARATH Myosin-5	78.000%	Swiss-Prot	High
`F4HXP9`	Arabidopsis thaliana	sp\|F4HXP9\|MYO9_ARATH Myosin-9	77.300%	Swiss-Prot	High
`F4HWY6`	Arabidopsis thaliana	sp\|F4HWY6\|MYO11_ARATH Myosin-11	75.900%	Swiss-Prot	High
`F4I460`	Arabidopsis thaliana	sp\|F4I460\|MYO8_ARATH Myosin-8	75.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card