Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1620 bp · TkA06G057390|TK1151|cDNA
CAAAGAAGACATTACAGTTGTATCTAGTCTCTACTACAACAATCAAGTTGTGCACATTGTGGTTAAATATCAGCACCTTTTAGTAACGAGAAAAAAAATCTTGGCTTATCATCTGGTTGTCCATGGCTCTTCGAGCAGCTTCTATTCTCCCATCTGCAATTTCCGTTCACAAGGAGGGGAAGTTGAATTCTTCTCTCAAGGAGAGTTCATTCAATGGGGCTTTCGTCTCAAAGAATGTCAAATCTGATTTCAGTTCTCTT...
1068 bp · TkA06G057390|TK1151|CDS
ATGGCTCTTCGAGCAGCTTCTATTCTCCCATCTGCAATTTCCGTTCACAAGGAGGGGAAGTTGAATTCTTCTCTCAAGGAGAGTTCATTCAATGGGGCTTTCGTCTCAAAGAATGTCAAATCTGATTTCAGTTCTCTTGTAATCGGAACTAAGGAGCTTAGAAGGAAGTCATCGTTCGGACCCATTCGAGCTCAAACGGCAACAGTAGCTCCATCCGTCACCGACGCCACACAAGACGGCAAGAAAACACTCAGGAAAGG...
Protein
Download Protein FASTA355 aa · TkA06G057390|TK1151|PROTEIN
MALRAASILPSAISVHKEGKLNSSLKESSFNGAFVSKNVKSDFSSLVIGTKELRRKSSFGPIRAQTATVAPSVTDATQDGKKTLRKGTVIITGASSGLGLATAKALADTQKWHIIMACRNFLKAEKAAKSVGITKENYTVMHLDLSSLDSVRQFVDTFRRSGRPLDALVCNAAIYLPTAKEPTYTADGFELSVGTNHLGHFLLSRLLLDDLQKSDFPQKRLIIVGSITGNTNTLAGNVPPKANLGDLRGLAGGLNGLNSS...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA06G057390 |
|---|---|
| TK1151 ID | TkA06G057390 |
| OH-1004 ID | LXL04_025474 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 98.028 / OH-1004 87.218Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA06G057390 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr06:15510264-15512264 (+) | |||||||||
| Description | Similar to POR1: Protochlorophyllide reductase, chloroplastic | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0009640 photomorphogenesis Biological Process GO:0009647 skotomorphogenesis Biological Process GO:0009723 response to ethylene Biological Process GO:0015979 photosynthesis Biological Process GO:0015995 chlorophyll biosynthetic process Biological Process GO:0005576 extracellular region Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009535 chloroplast thylakoid membrane Cellular Component GO:0009941 chloroplast envelope Cellular Component GO:0031969 chloroplast membrane Cellular Component GO:0003729 mRNA binding Molecular Function | |||||||||
| KEGG gene cross-reference | ath:AT1G03630 ath:AT5G54190 csv:101208554 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF12242Eno-Rase_NADH_b75-109 aaPF08659KR87-204 aaPF00106adh_short88-231 aaPF13561adh_short_C293-229 aaPF12242Eno-Rase_NADH_b218-229 aaPF00106adh_short269-311 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA06G057390 | PF12242 | Eno-Rase_NADH_b | 75 | 109 | 0.017 | 15.5 |
| TkA06G057390 | PF08659 | KR | 87 | 204 | 2.4e-08 | 34.8 |
| TkA06G057390 | PF00106 | adh_short | 88 | 231 | 6.5e-21 | 75.4 |
| TkA06G057390 | PF13561 | adh_short_C2 | 93 | 229 | 1.8e-09 | 38.3 |
| TkA06G057390 | PF12242 | Eno-Rase_NADH_b | 218 | 229 | 0.017 | 15.5 |
| TkA06G057390 | PF00106 | adh_short | 269 | 311 | 6.5e-21 | 75.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.