TkA06G055960 | RubberDandelionOmics

Gene overview

TkA06G055960

Reference: TK1151 Chr: Chr06 Coordinates: 15087178-15090646 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1702 bp · TkA06G055960|TK1151|cDNA

ACATGTCGGAAACATCTCGGAAACGTAAAGCTCGTGATCTTGATGAGAAGTCTCCTTTGGTTTTTTCAGAGTCTCTTGCTGAGTTCTTTGCGGAGAATAAGAACAATGCTGGGTTTGAGAACCCTGGGAAAGCGCTTTACACAACGGTGAAAGAACTTGTTGAAAATGGACTTGATTCTGCTGAGTCAATTGGGGAGTTTCCAGTGATTGGAGTAACAATTGAGGAGATTTCTAGAAGCTACTATGATTCCACGATTGAT...

CDS

Download CDS FASTA

987 bp · TkA06G055960|TK1151|CDS

ATGCGCCAAATGGCTGTTATTACTCCTTATGCCGAATTCAAGTTTGAATATATTGCAGCAGATGAAAATGGTGTGGTGAAAAAAAGTTATCCAAGAATTTCAGAGATAATGCCACGTGTTCCTGTAGAAACAAAGTACCATCCATCAGCCGTGGATTCGTTGTTTATCATCCAACGCCTAATTGGTCAAAGTCAAACGAATCTTTTGCAGTTTCTTTTGGATGAATTTGTTAAAATTAACAAGGCACAAGCTCTTAAATT...

Protein

Download Protein FASTA

329 aa · TkA06G055960|TK1151|PROTEIN

MRQMAVITPYAEFKFEYIAADENGVVKKSYPRISEIMPRVPVETKYHPSAVDSLFIIQRLIGQSQTNLLQFLLDEFVKINKAQALKLIGDMGPGVTSKTQVNSLTFPQIARMHKLFQQAQFDDPSGNCLSPLGEYGFGLGINQVLHPQLVKTYTAKRAQAYQGHPFIVEVGVSVGGNELKQGLNIFRFANRVPLLFEQDADVVTTTAMERIKWKRYKINKDRDKVGVFVNIVSTKKIPFKGTGDDISQIADAVKTCLDHC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G055960`
TK1151 ID	TkA06G055960
OH-1004 ID	LXL04_025509
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.900
Protein coverage (%)	TK1151 92.705 / OH-1004 55.135 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G055960

Location Chr06:15087178-15090646 (+)

Description Similar to TOP6B: DNA topoisomerase 6 subunit B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g20780`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	A crucial role for the putative Arabidopsis topoisomerase VI in plant growth and development.2002 · DOI: 10.1073/pnas.152337599 DNA topoisomerase VI is essential for endoreduplication in Arabidopsis.2002 · DOI: 10.1016/s0960-9822(02)01198-3

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8BDQ4`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release
`Os09g0279600`	Component of the DNA topoisomerase VI involved in chromatin organization and progression of endoreduplication cycles.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025509 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000902 cell morphogenesis Biological Process

GO:0006260 DNA replication Biological Process

GO:0006265 DNA topological change Biological Process

GO:0007389 pattern specification process Biological Process

GO:0009741 response to brassinosteroid Biological Process

GO:0010026 trichome differentiation Biological Process

GO:0042023 DNA endoreduplication Biological Process

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009330 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) complex Cellular Component

GO:0015935 small ribosomal subunit Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT3G20780

dosa:Os09g0279600

osa:4346606

sin:YN1551_1608

sshi:J5U23_02508

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.386

Rank 1 · TkA06G055960 · TK1151

Cytoplasm0.379

Rank 2 · TkA06G055960 · TK1151

Mitochondrion0.149

Rank 3 · TkA06G055960 · TK1151

Extracellular0.041

Rank 4 · TkA06G055960 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkA06G055960 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09239Topo-VIb_trans124-274 aa

PF22879AIPR_N208-272 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G055960	`PF09239`	Topo-VIb_trans	124	274	6.8e-43	146.9
TkA06G055960	`PF22879`	AIPR_N	208	272	0.068	13.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C5V6`	Arabidopsis thaliana	sp\|Q9C5V6\|TOP6B_ARATH DNA topoisomerase 6 subunit B	50.700%	Swiss-Prot	High
`B8BDQ4`	Oryza sativa subsp. indica	sp\|B8BDQ4\|TOP6B_ORYSI DNA topoisomerase 6 subunit B	57.200%	Swiss-Prot	High
`Q6H442`	Oryza sativa subsp. japonica	sp\|Q6H442\|TOP6B_ORYSJ DNA topoisomerase 6 subunit B	57.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card