TkA06G049870 | RubberDandelionOmics

Gene overview

TkA06G049870

Reference: TK1151 Chr: Chr06 Coordinates: 13577636-13578359 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

536 bp · TkA06G049870|TK1151|cDNA

ATGATGTTTTTTTTTTCTGGTTTCCGGACTTTCAGGTTGTCAAAAAAACTCGCCAACATGCAGAACGAAGAGGGACAGAAGTCACAGAATATGGATCTTTATATCCCAAGAAAGTGCTCTGCCACCAACAGGCTAATCACCTCAAAAGACCATGCTTCAGTCAAAATCAACATCTGGATGAAAGTGGCCGATATGTTGGTCAGTTTTCCACATTTGCCCTCTGTGGTTTTGTCCGTGCCCAGAGAGATGCTGACAGTGCC...

CDS

Download CDS FASTA

324 bp · TkA06G049870|TK1151|CDS

ATGATGTTTTTTTTTTCTGGTTTCCGGACTTTCAGGTTGTCAAAAAAACTCGCCAACATGCAGAACGAAGAGGGACAGAAGTCACAGAATATGGATCTTTATATCCCAAGAAAGTGCTCTGCCACCAACAGGCTAATCACCTCAAAAGACCATGCTTCAGTCAAAATCAACATCTGGATGAAAGTGGCCGATATGTTGGTCAGTTTTCCACATTTGCCCTCTGTGGTTTTGTCCGTGCCCAGAGAGATGCTGACAGTGCC...

Protein

Download Protein FASTA

107 aa · TkA06G049870|TK1151|PROTEIN

MMFFFSGFRTFRLSKKLANMQNEEGQKSQNMDLYIPRKCSATNRLITSKDHASVKINIWMKVADMLVSFPHLPSVVLSVPREMLTVPLIGCGRRRNLKSPIVLPCGL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G049870`
TK1151 ID	TkA06G049870
OH-1004 ID	LXL04_007679
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.100
Protein coverage (%)	TK1151 97.196 / OH-1004 84.553 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G049870

Location Chr06:13577636-13578359 (-)

Description Similar to RPS21: 40S ribosomal protein S21

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g27700`	Small ribosomal subunit protein eS21y.	No verified direct reference in this release
`At3g53890`	Small ribosomal subunit protein eS21z.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0345200`	Small ribosomal subunit protein eS21.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007679 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) Biological Process

GO:0006412 translation Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005840 ribosome Cellular Component

GO:0009536 plastid Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0022627 cytosolic small ribosomal subunit Cellular Component

GO:1990904 ribonucleoprotein complex Cellular Component

KEGG gene cross-reference

ath:AT3G53890

ath:AT5G27700

dosa:Os03g0345200

zma:542449

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.440

Rank 1 · TkA06G049870 · TK1151

Nucleus0.355

Rank 2 · TkA06G049870 · TK1151

Mitochondrion0.187

Rank 3 · TkA06G049870 · TK1151

Endoplasmic reticulum0.081

Rank 4 · TkA06G049870 · TK1151

Cell membrane0.068

Rank 5 · TkA06G049870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01249Ribosomal_S21e20-58 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G049870	`PF01249`	Ribosomal_S21e	20	58	4.7e-16	59.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q3E902`	Arabidopsis thaliana	sp\|Q3E902\|RS212_ARATH Small ribosomal subunit protein eS21y	79.500%	Swiss-Prot	Low
`Q9M337`	Arabidopsis thaliana	sp\|Q9M337\|RS211_ARATH Small ribosomal subunit protein eS21z	69.200%	Swiss-Prot	Low
`P35687`	Oryza sativa subsp. japonica	sp\|P35687\|RS21_ORYSJ Small ribosomal subunit protein eS21	76.900%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card