TkA06G048870 | RubberDandelionOmics

Gene overview

TkA06G048870

Reference: TK1151 Chr: Chr06 Coordinates: 13257902-13258814 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

843 bp · TkA06G048870|TK1151|cDNA

GCATTTGGATTCAGAATAGCTAGCAACAATTAAAAAGCCAAATCATACCTTTGAGGCAAACCGAATCACAGCAAATTAACAGAAATCAAGATATGGATCACAGATTATTAAAACACGACACTGAAGTTGCGGTAAAATCAACTAGGGGATTACTATTATCTAACCACATTACTCAAATTCTTCAACTTCTTCCAAGATCAATGCCACTAAAAGAGAAGCAAGTTCAGGGCCTAAATTGATTGAAATGGTGAAACAGAAGT...

CDS

Download CDS FASTA

426 bp · TkA06G048870|TK1151|CDS

ATGGTGAAACAGAAGTTGAATCATGGTGCCAAAATGATCCAACTTGACAGTCTAGGTAAAATCTTCAAGAAAACCTTCAGTATTCGAGAGGAAGAGAAATTGTTACAGGCTTCTCAATGCTACTTGTACACTACAGAAGGTGAAATTGCAGGCATCCTCTTTGTGTCTACAGAAAGGGTTGCATTTTGCAGTGATAGGCCGATGAAAACTTATTCTACCACAGGCAAGCTGCTAAAGTTCCATTATAAGGTGTCAATTCC...

Protein

Download Protein FASTA

141 aa · TkA06G048870|TK1151|PROTEIN

MVKQKLNHGAKMIQLDSLGKIFKKTFSIREEEKLLQASQCYLYTTEGEIAGILFVSTERVAFCSDRPMKTYSTTGKLLKFHYKVSIPLGKIQGVRESMNMKRQSYNYVELVTIDDFSFWFLGFVNYEKALRYLHHAIGLSA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G048870`
TK1151 ID	TkA06G048870
OH-1004 ID	LXL04_025614
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 38.843 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G048870

Location Chr06:13257902-13258814 (+)

Description Similar to At5g23360: GEM-like protein 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g23360`	GEM-like protein 7.	No verified direct reference in this release
`At5g23350`	GEM-like protein 6.	No verified direct reference in this release
`At5g23370`	Putative GEM-like protein 8.	No verified direct reference in this release
`At5g08350`	GEM-like protein 4.	No verified direct reference in this release
`At1g28200`	GEM-like protein 1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025614 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT5G23350

ath:AT5G23360

ath:AT5G23370

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.617

Rank 1 · TkA06G048870 · TK1151

Nucleus0.308

Rank 2 · TkA06G048870 · TK1151

Cell membrane0.144

Rank 3 · TkA06G048870 · TK1151

Lysosome / Vacuole0.065

Rank 4 · TkA06G048870 · TK1151

Endoplasmic reticulum0.049

Rank 5 · TkA06G048870 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02893GRAM21-134 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G048870	`PF02893`	GRAM	21	134	2.4e-10	41.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FMW5`	Arabidopsis thaliana	sp\|Q9FMW5\|GEML7_ARATH GEM-like protein 7	52.900%	Swiss-Prot	High
`Q9FMW6`	Arabidopsis thaliana	sp\|Q9FMW6\|GEML6_ARATH GEM-like protein 6	53.700%	Swiss-Prot	High
`Q9FMW4`	Arabidopsis thaliana	sp\|Q9FMW4\|GEML8_ARATH Putative GEM-like protein 8	51.800%	Swiss-Prot	High
`Q9FTA0`	Arabidopsis thaliana	sp\|Q9FTA0\|GEML4_ARATH GEM-like protein 4	51.100%	Swiss-Prot	High
`Q9SE96`	Arabidopsis thaliana	sp\|Q9SE96\|GEML1_ARATH GEM-like protein 1	35.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card