TkA06G046250 | RubberDandelionOmics

Gene overview

TkA06G046250

Reference: TK1151 Chr: Chr06 Coordinates: 12537328-12539287 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1461 bp · TkA06G046250|TK1151|cDNA

ATGGTAGCTGATCTGTTCATTGGCTTTCGAAAAAGGAGATTTTGGTTTCCATGTAAATATTTCTCTCTAAATGCTGTTTCTATCACAGTGATAGCTGTCGCAATGAAACTCCCCGTAGATTTGAACAGTCCAATGCCAGGGTGGACAGAGCAAACAGGTAAGCAAGCAAGCTTAGTTTTTTTATGCATCATGATGGCAAACTTGATGCCTTCTTTGGCGTCTATGGACAATAAGTCACTTTTTGCAAATGTCATAGTTCC...

CDS

Download CDS FASTA

1461 bp · TkA06G046250|TK1151|CDS

ATGGTAGCTGATCTGTTCATTGGCTTTCGAAAAAGGAGATTTTGGTTTCCATGTAAATATTTCTCTCTAAATGCTGTTTCTATCACAGTGATAGCTGTCGCAATGAAACTCCCCGTAGATTTGAACAGTCCAATGCCAGGGTGGACAGAGCAAACAGGTAAGCAAGCAAGCTTAGTTTTTTTATGCATCATGATGGCAAACTTGATGCCTTCTTTGGCGTCTATGGACAATAAGTCACTTTTTGCAAATGTCATAGTTCC...

Protein

Download Protein FASTA

486 aa · TkA06G046250|TK1151|PROTEIN

MVADLFIGFRKRRFWFPCKYFSLNAVSITVIAVAMKLPVDLNSPMPGWTEQTGKQASLVFLCIMMANLMPSLASMDNKSLFANVIVPITKKILELKYQAISKSTLYNHCSQDIFAIEKLRQHVQRCWIMAETGVIAPICRCFTVVSFKSFGRWNRNHLEVFKVEKHWTKKLSEWKESHIAFLLGGRRSRSILCNSLKEMMFSLPSTNDNIDGDLSNYILLLDDNMQLAEGTLKRISNSMNRLIQKVEKEQDNNLLKFLEK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G046250`
TK1151 ID	TkA06G046250
OH-1004 ID	LXL04_025669
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	54.600
Protein coverage (%)	TK1151 96.914 / OH-1004 35.746 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G046250`
Location	Chr06:12537328-12539287 (+)
Description	Similar to RPS3A: 40S ribosomal protein S3-1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025669` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0000325 plant-type vacuole Cellular Component GO:0005634 nucleus Cellular Component GO:0005730 nucleolus Cellular Component GO:0005777 peroxisome Cellular Component GO:0005829 cytosol Cellular Component GO:0009506 plasmodesma Cellular Component GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0022626 cytosolic ribosome Cellular Component GO:0022627 cytosolic small ribosomal subunit Cellular Component GO:0003729 mRNA binding Molecular Function
KEGG gene cross-reference	ath:AT2G31610 ath:AT3G53870 ath:AT5G35530 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.244

Rank 1 · TkA06G046250 · TK1151

Cytoplasm0.236

Rank 2 · TkA06G046250 · TK1151

Cell membrane0.233

Rank 3 · TkA06G046250 · TK1151

Mitochondrion0.187

Rank 4 · TkA06G046250 · TK1151

Endoplasmic reticulum0.172

Rank 5 · TkA06G046250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF20890Dbr1_C7-24 aa

PF28351CLZ1_N35-78 aa

PF20890Dbr1_C84-113 aa

PF20648DUF6809159-176 aa

PF30198Tyr_recomb_halo_M214-259 aa

PF20648DUF6809232-273 aa

PF20890Dbr1_C234-276 aa

PF20648DUF6809328-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G046250	`PF20890`	Dbr1_C	7	24	0.15	13.1
TkA06G046250	`PF28351`	CLZ1_N	35	78	0.05	14.7
TkA06G046250	`PF20890`	Dbr1_C	84	113	0.15	13.1
TkA06G046250	`PF20648`	DUF6809	159	176	0.27	12.8
TkA06G046250	`PF30198`	Tyr_recomb_halo_M	214	259	0.25	12.6
TkA06G046250	`PF20648`	DUF6809	232	273	0.27	12.8
TkA06G046250	`PF20890`	Dbr1_C	234	276	0.15	13.1
TkA06G046250	`PF20648`	DUF6809	328	365	0.27	12.8
TkA06G046250	`PF30198`	Tyr_recomb_halo_M	337	386	0.25	12.6
TkA06G046250	`PF28351`	CLZ1_N	398	447	0.05	14.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card