TkA06G045720 | RubberDandelionOmics

Gene overview

TkA06G045720

Reference: TK1151 Chr: Chr06 Coordinates: 12412991-12415464 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

977 bp · TkA06G045720|TK1151|cDNA

AAAAAACTTTGTTTGTAATGTTCTATATCTTCTTTAAAAGGGCTATCAACCACAATAATCTCATAACCATCTAAGATTTCGTCATACACACTTCCGTTGGGATTTCCCTTCCAAACAAGCAATTCCCTTGCTGTTATCACATGAAAATTATGGCAGTTGTGAGTGCACCTTCGACTCTCCCTCTATCAACGATTGTCCATCCCTCACAAACTCCCAAATCTCGTACTGTATCGTTTACAACCAGAGCATCTCTCTCTTCG...

CDS

Download CDS FASTA

537 bp · TkA06G045720|TK1151|CDS

ATGAAAATTATGGCAGTTGTGAGTGCACCTTCGACTCTCCCTCTATCAACGATTGTCCATCCCTCACAAACTCCCAAATCTCGTACTGTATCGTTTACAACCAGAGCATCTCTCTCTTCGGTTTCAGTTTCAAATTCAAATGCGGCTATCAAGGCTAGGTTTGGATCTTCAAGAGGAGGAGCTGGCGTGTTGGAACGACCTTCGTTTGATCAATCTCAGCTCGACCCTTCTACCCAAGTTCAAGAAGGTGGAGATATTGG...

Protein

Download Protein FASTA

178 aa · TkA06G045720|TK1151|PROTEIN

MKIMAVVSAPSTLPLSTIVHPSQTPKSRTVSFTTRASLSSVSVSNSNAAIKARFGSSRGGAGVLERPSFDQSQLDPSTQVQEGGDIGRVRDKKPTGSGDSYRVLLIDDERHTENLVAKALPQAVPGVTPEDARKLFHLSRESGLAVVLVTVKEHAEFYAQMMMRKGLRSTIEPDSTTV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G045720`
TK1151 ID	TkA06G045720
OH-1004 ID	LXL04_025679
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	96.600
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G045720`
Location	Chr06:12412991-12415464 (-)
Description	Similar to clpS: ATP-dependent Clp protease adapter protein ClpS (Gloeobacter violaceus (strain ATCC 29082 / PCC 7421)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_025679` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006508 proteolysis Biological Process GO:0030163 protein catabolic process Biological Process GO:1903052 positive regulation of proteolysis involved in protein catabolic process Biological Process GO:0009570 chloroplast stroma Cellular Component GO:0008233 peptidase activity Molecular Function GO:0030674 protein-macromolecule adaptor activity Molecular Function
KEGG gene cross-reference	ath:AT1G68660 cre:CHLRE_12g559150v5 gvi:gsl0746 sye:Syncc9902_2032 syn:ssl3379 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.976

Rank 1 · TkA06G045720 · TK1151

Mitochondrion0.026

Rank 2 · TkA06G045720 · TK1151

Nucleus0.021

Rank 3 · TkA06G045720 · TK1151

Cytoplasm0.012

Rank 4 · TkA06G045720 · TK1151

Cell membrane0.009

Rank 5 · TkA06G045720 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02617ClpS99-168 aa

PF23057RBD_ZCCHC3_1st108-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G045720	`PF02617`	ClpS	99	168	5.3e-06	26.8
TkA06G045720	`PF23057`	RBD_ZCCHC3_1st	108	165	0.025	15.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card