TkA06G041010 | RubberDandelionOmics

Gene overview

TkA06G041010

Reference: TK1151 Chr: Chr06 Coordinates: 11087341-11090283 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1678 bp · TkA06G041010|TK1151|cDNA

TCCTTGCAGATGGATGGCTTTGTGTTACCACCTTTTGAGTCGACTGAAATCTTGAAAGATAAGGAACTTATAAGTGTAAAAAGAAAGGTGAGACCACATCTGATGCAGACAATCTGCTTGATGACGTGGAAGTTGATGACATGGAACCTGGAGACAATGGTTTGCTACTTTTAGCAAATGATAAACGAACTGAAGAACCCCAAAATGAATCTGAGGAAGTTGATGAAGAACATTCACATGAAGAACCAGTTTGTAAGAAA...

CDS

Download CDS FASTA

1020 bp · TkA06G041010|TK1151|CDS

ATGGCTAGTAGAAGCGCAAGAAGGAAAAAGGCAAAGAGACAGTGGATGCAAGAACTGGCTAAAATCGGAAAGAAGAAGCCACAACAGTATTCAAAGCCTGAAGTAACTAAACCTGAAAACAGAGATGCTAATGGAGGGCCCAAGGGACTACTACATTGGAAACAAGCATCTTCTCAAAAGCCTGTGCATAAGAACAGATTACAACAATCAAGAAATCAGAATGGGGATGTGGATTTCGGTGTTGTAACTAAACCAGGACA...

Protein

Download Protein FASTA

339 aa · TkA06G041010|TK1151|PROTEIN

MASRSARRKKAKRQWMQELAKIGKKKPQQYSKPEVTKPENRDANGGPKGLLHWKQASSQKPVHKNRLQQSRNQNGDVDFGVVTKPGHIRFQNYDEDEGEKQTAVSNETFRRNSSNGKKKGQRWGGSTGKFANYQRNESKRIDKKSLKIPITDMQVPVIDPNDFNKLPPCCEPKEGDVIAYRLLELSSSWIPEFSSFRVGRISYYDARDIVLIPVPEYPFETDKTDDNRPNDSLYGEDGSLEINYSALLDVCYVKQYDPEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G041010`
TK1151 ID	TkA06G041010
OH-1004 ID	LXL04_025802
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 100.000 / OH-1004 54.943 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G041010

Location Chr06:11087341-11090283 (+)

Description Similar to COIL: Coilin

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g13030`	Probable component of nuclear coiled bodies, also known as Cajal bodies or CBs, which are involved in the modification and assembly of nucleoplasmic snRNPs (Probable).	A distant coilin homologue is required for the formation of cajal bodies in Arabidopsis.2006 · DOI: 10.1091/mbc.e05-12-1157

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025802 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000387 spliceosomal snRNP assembly Biological Process

GO:0006396 RNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0015030 Cajal body Cellular Component

GO:0030619 U1 snRNA binding Molecular Function

GO:0030620 U2 snRNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G13030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.913

Rank 1 · TkA06G041010 · TK1151

Cytoplasm0.194

Rank 2 · TkA06G041010 · TK1151

Cell membrane0.026

Rank 3 · TkA06G041010 · TK1151

Mitochondrion0.017

Rank 4 · TkA06G041010 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA06G041010 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16027DUF478625-77 aa

PF23086Tudor_Coilin160-255 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G041010	`PF16027`	DUF4786	25	77	0.059	14.6
TkA06G041010	`PF23086`	Tudor_Coilin	160	255	3.3e-36	124.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWK8`	Arabidopsis thaliana	sp\|Q8RWK8\|COIL_ARATH Coilin	36.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card