TkA06G033850 | RubberDandelionOmics

Gene overview

TkA06G033850

Reference: TK1151 Chr: Chr06 Coordinates: 9150777-9160556 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2443 bp · TkA06G033850|TK1151|cDNA

TTTAACTTCAACGATACAAAAATAAACAAATTTCAATTTCTAAAAATACATTCCGAATTCGATCGCATTATGACAAAATTTATACCCAGGTATAGCTACAAAATAAACTCTTCGCGGTGATTATTCAACCTGCCTACAAACTTCCCCACATCTAATCAGTTAATCGATCGTGGGTTAGAATTCACCGGTTAAATTGGGGTTTGGCGTTAGGGTTTAGGGAAATTGCAATTTCTTCCAAAATCACGAGATTATCGTTTTAT...

CDS

Download CDS FASTA

1233 bp · TkA06G033850|TK1151|CDS

ATGGACTTCGATCATGATAATGTTAGACTAGCAGTAGAAGAAGATCGATTAAGCAGCTTACCAGATGAGCTTATTCATAAGATCCTGTCTTCTTTTGACACAAAATTTGCTGTTCAAACATGTTTGCTGTCACCAAGATGGAAGCTTCTCTGGACATCAATCCCCTCTCTCAACTTCTCAAGTGGCCAATTTCCTGCTTTACCAAAGTTTTCCAAATTTATCACCAATGTTCTCTCTCACCGAAACCATCAAATAGAAGT...

Protein

Download Protein FASTA

410 aa · TkA06G033850|TK1151|PROTEIN

MDFDHDNVRLAVEEDRLSSLPDELIHKILSSFDTKFAVQTCLLSPRWKLLWTSIPSLNFSSGQFPALPKFSKFITNVLSHRNHQIEVSSVNLDFHGAASQVFVKKIANYAFSHNIQQLTVSCWPKKHYQFPPSLFTSHSLKHFTISNGPFNFSPSITPKTPWDFPSLTSLHISHITLCDNHTQNSLDLFSKCVNLTNLTLETPHGQERGVFDIITPRLSNLTLYYGKFEPVINLIAPQLKNLTITNCSIDYLNVPPQLSS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G033850`
TK1151 ID	TkA06G033850
OH-1004 ID	LXL04_025891
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	94.100
Protein coverage (%)	TK1151 98.537 / OH-1004 69.775 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G033850

Location Chr06:9150777-9160556 (+)

Description Similar to At3g26920: F-box/FBD/LRR-repeat protein At3g26920

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02910`	F-box/LRR-repeat protein At5g02910.	No verified direct reference in this release
`At2g29910`	F-box/LRR-repeat protein At2g29910.	No verified direct reference in this release
`At2g29930`	F-box/LRR-repeat protein At2g29930.	No verified direct reference in this release
`At1g32020`	Putative F-box protein At1g32020.	No verified direct reference in this release
`At3g49480`	Putative F-box/FBD/LRR-repeat protein At3g49480.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025891 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT2G04230

ath:AT3G26920

ath:AT5G56420

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.851

Rank 1 · TkA06G033850 · TK1151

Cytoplasm0.190

Rank 2 · TkA06G033850 · TK1151

Endoplasmic reticulum0.035

Rank 3 · TkA06G033850 · TK1151

Cell membrane0.035

Rank 4 · TkA06G033850 · TK1151

Plastid0.017

Rank 5 · TkA06G033850 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF15966F-box_414-39 aa

PF00646F-box17-55 aa

PF12937F-box-like17-49 aa

PF23622LRR_At1g61320_AtMIF184-246 aa

PF13306LRR_5103-147 aa

PF15966F-box_4137-183 aa

PF12799LRR_4158-174 aa

PF12799LRR_4166-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G033850	`PF15966`	F-box_4	14	39	0.1	13.2
TkA06G033850	`PF00646`	F-box	17	55	1.9e-06	28.3
TkA06G033850	`PF12937`	F-box-like	17	49	0.18	12.3
TkA06G033850	`PF23622`	LRR_At1g61320_AtMIF1	84	246	2.2e-06	28.0
TkA06G033850	`PF13306`	LRR_5	103	147	0.013	16.1
TkA06G033850	`PF15966`	F-box_4	137	183	0.1	13.2
TkA06G033850	`PF12799`	LRR_4	158	174	5.5	8.1
TkA06G033850	`PF12799`	LRR_4	166	200	5.5	8.1
TkA06G033850	`PF13306`	LRR_5	172	200	0.013	16.1
TkA06G033850	`PF23622`	LRR_At1g61320_AtMIF1	237	284	2.2e-06	28.0
TkA06G033850	`PF12799`	LRR_4	237	249	5.5	8.1
TkA06G033850	`PF13306`	LRR_5	244	261	0.013	16.1
TkA06G033850	`PF15966`	F-box_4	316	333	0.1	13.2
TkA06G033850	`PF00646`	F-box	317	330	1.9e-06	28.3
TkA06G033850	`PF12799`	LRR_4	338	344	5.5	8.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LYZ4`	Arabidopsis thaliana	sp\|Q9LYZ4\|FBL79_ARATH F-box/LRR-repeat protein At5g02910	30.900%	Swiss-Prot	Low
`Q1PEY8`	Arabidopsis thaliana	sp\|Q1PEY8\|FBL35_ARATH F-box/LRR-repeat protein At2g29910	28.300%	Swiss-Prot	Low
`Q84RK6`	Arabidopsis thaliana	sp\|Q84RK6\|FBL36_ARATH F-box/LRR-repeat protein At2g29930	28.000%	Swiss-Prot	Low
`Q9C6W9`	Arabidopsis thaliana	sp\|Q9C6W9\|FB28_ARATH Putative F-box protein At1g32020	29.400%	Swiss-Prot	Low
`Q9CA04`	Arabidopsis thaliana	sp\|Q9CA04\|FDL45_ARATH Putative F-box/FBD/LRR-repeat protein At3g49480	52.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card