TkA06G033510 | RubberDandelionOmics

Gene overview

TkA06G033510

Reference: TK1151 Chr: Chr06 Coordinates: 9063140-9064072 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

453 bp · TkA06G033510|TK1151|cDNA

ATGTATCCGGACCCATCGCTCTTTGGTCGGACCGGATACAGAGAGAAAGACGGCGATGGAGAGGTGTTTACTATCGATCGATGGAAGAGCAAAAGGGGTTCGATTTCAAAATCATCCAATTCGGCTTCTTCAGGAACCCTCTCCTTTGTTTTTCTGCAATTGATTTCTGCGTTAGGCAATCAGGCCATGCCTGCAAAAGGAAGGAGTAAGATTTTTCTTGATATTGCTGATGCTCTTGAAGCAAATGAGAAGGTGATTGT...

CDS

Download CDS FASTA

453 bp · TkA06G033510|TK1151|CDS

ATGTATCCGGACCCATCGCTCTTTGGTCGGACCGGATACAGAGAGAAAGACGGCGATGGAGAGGTGTTTACTATCGATCGATGGAAGAGCAAAAGGGGTTCGATTTCAAAATCATCCAATTCGGCTTCTTCAGGAACCCTCTCCTTTGTTTTTCTGCAATTGATTTCTGCGTTAGGCAATCAGGCCATGCCTGCAAAAGGAAGGAGTAAGATTTTTCTTGATATTGCTGATGCTCTTGAAGCAAATGAGAAGGTGATTGT...

Protein

Download Protein FASTA

150 aa · TkA06G033510|TK1151|PROTEIN

MYPDPSLFGRTGYREKDGDGEVFTIDRWKSKRGSISKSSNSASSGTLSFVFLQLISALGNQAMPAKGRSKIFLDIADALEANEKVIVHENEADVAVAQDAGYETSLISRLALKPGKVSHNLINYTEVPGYKKLYRNGHCLIISQKWSLSD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G033510`
TK1151 ID	TkA06G033510
OH-1004 ID	LXL04_025883
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G033510

Location Chr06:9063140-9064072 (-)

Description Similar to Delta-1-pyrroline-5-carboxylate synthase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g55610`	P5CS plays a key role in proline biosynthesis, leading to osmoregulation in plants.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_025883 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0055129 L-proline biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0004349 glutamate 5-kinase activity Molecular Function

GO:0004350 glutamate-5-semialdehyde dehydrogenase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

dosa:Os05g0455500

osa:4338979

sly:544281

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.339

Rank 1 · TkA06G033510 · TK1151

Nucleus0.321

Rank 2 · TkA06G033510 · TK1151

Mitochondrion0.179

Rank 3 · TkA06G033510 · TK1151

Cell membrane0.118

Rank 4 · TkA06G033510 · TK1151

Plastid0.087

Rank 5 · TkA06G033510 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23746Gp41_Mu74-117 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G033510	`PF23746`	Gp41_Mu	74	117	0.2	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P54888`	Arabidopsis thaliana	sp\|P54888\|P5CS2_ARATH Delta-1-pyrroline-5-carboxylate synthase B	58.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card