TkA06G031710 | RubberDandelionOmics

Gene overview

TkA06G031710

Reference: TK1151 Chr: Chr06 Coordinates: 8622430-8628587 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3257 bp · TkA06G031710|TK1151|cDNA

TCTCATTGGTGCTTCCTTTCTCCCAATGGCCCAATCCTTACCTTTATACTAAAACCATCTTCCTACAAAAGGCCTGAACTTCCAAGAACACAAGATCCAAGAAACCTCCAAATTTCAGCATTACAAGATTCCGAATTCCCCATTAATTAAACCAACAAAAATCACATTGGATATCCTTCATCCGTCAATATGTGCCGTTTCTCATACAGTATCACCACTTTTAACTTTTCCCACCACCCACTACTACAAAAAACAATCAT...

CDS

Download CDS FASTA

2910 bp · TkA06G031710|TK1151|CDS

ATGGCGACACACCCATCTGCAACAACAAACGTTCACACCACGAAGAAGAAGAAGAAAGCAAAAGTGAAATGGAGCAATCTGTACACGTTTTCATGCTTACGTCCACCGCCTCCATTAAACCAATCAGATTTCGGCCATCCCGGGTTCTCTAGAGTCGTGTTCTGTAATAATCCGGGGGCCCACAAAACTAAACCGTATAAATATCCAATCAACGAAGTCTCCACGACTAAGTATAATGTGGTAACGTTTTTTCCAAAATC...

Protein

Download Protein FASTA

969 aa · TkA06G031710|TK1151|PROTEIN

MATHPSATTNVHTTKKKKKAKVKWSNLYTFSCLRPPPPLNQSDFGHPGFSRVVFCNNPGAHKTKPYKYPINEVSTTKYNVVTFFPKSLFEQFRRVANLYFLLVAVLSVTSLAPFTPLSLIAPLVFVVGISMLKEGVEDWHRFLQDLEVNSRKVKVHIGNGSFVDRSWKVLRVGDVVKVNKNEYFPCDLLLLSSSYEDGVCYVETMNLDGETNLKIKRCLECTLGFDEEVKFDKFEAKIRCEDPNSSLYTFVANLEFGDKD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G031710`
TK1151 ID	TkA06G031710
OH-1004 ID	LXL04_026014
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 76.299 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G031710

Location Chr06:8622430-8628587 (+)

Description Similar to ALA4: Probable phospholipid-transporting ATPase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g17500`	Involved in transport of phospholipids.	No verified direct reference in this release
`At1g72700`	Involved in transport of phospholipids.	No verified direct reference in this release
`At3g13900`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At1g54280`	Involved in transport of phospholipids and in regulation of pollen plasma membrane lipid asymmetry.	Loss of the Arabidopsis thaliana P4-ATPases ALA6 and ALA7 impairs pollen fitness and alters the pollen tube plasma membrane.2015 · DOI: 10.3389/fpls.2015.00197
`At1g68710`	Involved in transport of phospholipids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026014 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009860 pollen tube growth Biological Process

GO:0010286 heat acclimation Biological Process

GO:0045332 phospholipid translocation Biological Process

GO:1901703 protein localization involved in auxin polar transport Biological Process

GO:1905038 regulation of membrane lipid metabolic process Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0012505 endomembrane system Cellular Component

GO:0000287 magnesium ion binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G17500

ath:AT1G54280

ath:AT1G68710

ath:AT1G72700

ath:AT3G13900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.313

Rank 1 · TkA06G031710 · TK1151

Cell membrane0.270

Rank 2 · TkA06G031710 · TK1151

Golgi apparatus0.235

Rank 3 · TkA06G031710 · TK1151

Lysosome / Vacuole0.155

Rank 4 · TkA06G031710 · TK1151

Cytoplasm0.112

Rank 5 · TkA06G031710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16209PhoLip_ATPase_N53-119 aa

PF00122E1-E2_ATPase149-213 aa

PF16209PhoLip_ATPase_N327-345 aa

PF00702Hydrolase447-466 aa

PF18599LCIB_C_CA497-530 aa

PF13246Cation_ATPase569-765 aa

PF18140PCC_BT594-674 aa

PF00702Hydrolase726-829 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G031710	`PF16209`	PhoLip_ATPase_N	53	119	3.8e-22	78.5
TkA06G031710	`PF00122`	E1-E2_ATPase	149	213	0.0032	17.9
TkA06G031710	`PF16209`	PhoLip_ATPase_N	327	345	3.8e-22	78.5
TkA06G031710	`PF00702`	Hydrolase	447	466	3.1e-11	44.7
TkA06G031710	`PF18599`	LCIB_C_CA	497	530	0.24	11.4
TkA06G031710	`PF13246`	Cation_ATPase	569	765	3.2e-17	63.6
TkA06G031710	`PF18140`	PCC_BT	594	674	0.099	13.5
TkA06G031710	`PF00702`	Hydrolase	726	829	3.1e-11	44.7
TkA06G031710	`PF18599`	LCIB_C_CA	738	763	0.24	11.4
TkA06G031710	`PF25109`	HAD_PNKP	761	843	0.15	12.9
TkA06G031710	`PF18140`	PCC_BT	837	891	0.099	13.5
TkA06G031710	`PF00702`	Hydrolase	863	925	3.1e-11	44.7
TkA06G031710	`PF08282`	Hydrolase_3	901	929	0.00028	21.4
TkA06G031710	`PF16212`	PhoLip_ATPase_C	939	969	5.2e-13	50.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LNQ4`	Arabidopsis thaliana	sp\|Q9LNQ4\|ALA4_ARATH Probable phospholipid-transporting ATPase 4	58.300%	Swiss-Prot	High
`Q9SGG3`	Arabidopsis thaliana	sp\|Q9SGG3\|ALA5_ARATH Probable phospholipid-transporting ATPase 5	58.100%	Swiss-Prot	High
`Q9LVK9`	Arabidopsis thaliana	sp\|Q9LVK9\|ALA7_ARATH Probable phospholipid-transporting ATPase 7	57.600%	Swiss-Prot	High
`Q9SLK6`	Arabidopsis thaliana	sp\|Q9SLK6\|ALA6_ARATH Phospholipid-transporting ATPase 6	57.800%	Swiss-Prot	High
`Q9SX33`	Arabidopsis thaliana	sp\|Q9SX33\|ALA9_ARATH Putative phospholipid-transporting ATPase 9	52.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card