TkA06G028360 | RubberDandelionOmics

Gene overview

TkA06G028360

Reference: TK1151 Chr: Chr06 Coordinates: 7685709-7690419 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

980 bp · TkA06G028360|TK1151|cDNA

CGGCGACGGGCGCTCACCACCGTACTCCACCTGACATCGCCGGTTAACGAAACCAGCTAAAAATAGACGCTCGTTTTGCTCCGTTCCAGTTTAAGAACGTGCTCAATGCGTTTGAGAAGTATCGGTACATCAAAACAGTTCGGGTAATCGAAATTAGGTACGCAGCTCTCTTGCTTTGAATTTTGGTTGCATTAAACCCTGCTCAAAAGAAATGAATCGAAGTCGTATGAATCCAAAAATTCTCAAATCAGCTCTGAATA...

CDS

Download CDS FASTA

717 bp · TkA06G028360|TK1151|CDS

ATGAATCGAAGTCGTATGAATCCAAAAATTCTCAAATCAGCTCTGAATATCCGTCACTTCTCAAAGTCTGCCTTTTCATCCCTACAGACGTTACCCGATTCAAGAACAAATTCACTCATAAATCCACTTTACAATCTTCTTCCTCACACCCAAAACCCTAGCAAAATCGTCGATATAATATGCACAAATCTCAAACAAGGAAGCACCACGCTTCTTGACAAAGACATGATCCCTCATTTGGGCACCGAAGAAGTCTCAAG...

Protein

Download Protein FASTA

238 aa · TkA06G028360|TK1151|PROTEIN

MNRSRMNPKILKSALNIRHFSKSAFSSLQTLPDSRTNSLINPLYNLLPHTQNPSKIVDIICTNLKQGSTTLLDKDMIPHLGTEEVSRVLLRCQSDPSAALTFFNWVKNDLAFLPTMHNYCLMLHILAWSRKFPQTMNLFSELIQLNRDKPEKASIFENLVQCTKDCSYEPVIFDILLKAYLKAGLIRDGFVTFRKMIKLGFVPKIISINFLLDGLLKLNRINECWGIYEEMEKIGVRG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G028360`
TK1151 ID	TkA06G028360
OH-1004 ID	LXL04_036456
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	24.400
Protein coverage (%)	TK1151 79.832 / OH-1004 9.035 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G028360

Location Chr06:7685709-7690419 (-)

Description Similar to At5g59900: Putative pentatricopeptide repeat-containing protein At5g59900

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40400`	Pentatricopeptide repeat-containing protein At5g40400.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036456 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005739 mitochondrion Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0003729 mRNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G39710

ath:AT5G59900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.771

Rank 1 · TkA06G028360 · TK1151

Plastid0.119

Rank 2 · TkA06G028360 · TK1151

Nucleus0.060

Rank 3 · TkA06G028360 · TK1151

Cytoplasm0.033

Rank 4 · TkA06G028360 · TK1151

Cell membrane0.008

Rank 5 · TkA06G028360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13041PPR_295-124 aa

PF13041PPR_2118-143 aa

PF01535PPR119-144 aa

PF23276TPR_24165-233 aa

PF29070MSC6_N167-224 aa

PF13041PPR_2171-203 aa

PF01535PPR171-201 aa

PF13041PPR_2203-236 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G028360	`PF13041`	PPR_2	95	124	1.7e-11	44.7
TkA06G028360	`PF13041`	PPR_2	118	143	1.7e-11	44.7
TkA06G028360	`PF01535`	PPR	119	144	8.2e-10	39.0
TkA06G028360	`PF23276`	TPR_24	165	233	0.024	15.3
TkA06G028360	`PF29070`	MSC6_N	167	224	0.12	12.2
TkA06G028360	`PF13041`	PPR_2	171	203	1.7e-11	44.7
TkA06G028360	`PF01535`	PPR	171	201	8.2e-10	39.0
TkA06G028360	`PF13041`	PPR_2	203	236	1.7e-11	44.7
TkA06G028360	`PF01535`	PPR	209	236	8.2e-10	39.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FND8`	Arabidopsis thaliana	sp\|Q9FND8\|PP409_ARATH Pentatricopeptide repeat-containing protein At5g40400	42.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card