TkA06G028150 | RubberDandelionOmics

Gene overview

TkA06G028150

Reference: TK1151 Chr: Chr06 Coordinates: 7624619-7626870 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1559 bp · TkA06G028150|TK1151|cDNA

CCCACATGTTCGTTTCTTTGAGCAAAAGAAAACACCGACGACGATACAGAGGAAGGGTTTTATATATAAGCTTTTCTAACCGGAGGCCTCCTCTCGCAACTCACTGTCGTCGGAGCAGTCGAAGATGGCGGCTCTTGAGTATCTTGATTCTCTTCGTAGTACTCATCCCGAGCTGTCGGATTGGTACAATACGCTTGCCGATCTGTACCAAAGGAAGCTATGGCATCAGCTCACTCTGAAGCTCGAACAGTTCGTTGCTC...

CDS

Download CDS FASTA

1161 bp · TkA06G028150|TK1151|CDS

ATGGCGGCTCTTGAGTATCTTGATTCTCTTCGTAGTACTCATCCCGAGCTGTCGGATTGGTACAATACGCTTGCCGATCTGTACCAAAGGAAGCTATGGCATCAGCTCACTCTGAAGCTCGAACAGTTCGTTGCTCTTGCCGTTTTTCAGGCGGGTGATGCTCTCATACAACTATACCACCATTTCATAACTGATTTCGAGACCAAAATCAACCTCCTGAAGCTGGCCCACTTTGCAGTCATAGTCTCCAGACAATATTC...

Protein

Download Protein FASTA

386 aa · TkA06G028150|TK1151|PROTEIN

MAALEYLDSLRSTHPELSDWYNTLADLYQRKLWHQLTLKLEQFVALAVFQAGDALIQLYHHFITDFETKINLLKLAHFAVIVSRQYSEKEAAIGYLDGIIEKLRATKETRIEEPVLYIKMQIAIFNLEKGDQKECKNLLEDGKSTLDSMTDIDPSVYANYYWVSSQYHKTRQEFAEFYKSALLYLAYTSVESLSDSFKLDLAFDLSLSALLGENVYNFGELLAHPIIKSLLGTKVEWLYYILEAFNSGDLVKYQELCRVH...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G028150`
TK1151 ID	TkA06G028150
OH-1004 ID	LXL04_029224
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G028150

Location Chr06:7624619-7626870 (+)

Description Similar to RPN9B: 26S proteasome non-ATPase regulatory subunit 13 homolog B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45620`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release
`At4g19006`	Acts as a regulatory subunit of the 26S proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_029224 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0007127 meiosis I Biological Process

GO:0010498 proteasomal protein catabolic process Biological Process

GO:0030163 protein catabolic process Biological Process

GO:0000502 proteasome complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005838 proteasome regulatory particle Cellular Component

GO:0008541 proteasome regulatory particle, lid subcomplex Cellular Component

GO:0022624 proteasome accessory complex Cellular Component

GO:0005198 structural molecule activity Molecular Function

KEGG gene cross-reference

ath:AT4G19006

ath:AT5G45620

bta:513525

ddi:DDB_G0285105

rno:365388

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.591

Rank 1 · TkA06G028150 · TK1151

Nucleus0.520

Rank 2 · TkA06G028150 · TK1151

Lysosome / Vacuole0.083

Rank 3 · TkA06G028150 · TK1151

Golgi apparatus0.081

Rank 4 · TkA06G028150 · TK1151

Endoplasmic reticulum0.069

Rank 5 · TkA06G028150 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF22037PSD13_N21-242 aa

PF01399PCI264-344 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G028150	`PF22037`	PSD13_N	21	242	1e-72	245.5
TkA06G028150	`PF01399`	PCI	264	344	3.7e-10	40.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RWF0`	Arabidopsis thaliana	sp\|Q8RWF0\|PS13A_ARATH 26S proteasome non-ATPase regulatory subunit 13 homolog A	83.200%	Swiss-Prot	High
`Q8GYA6`	Arabidopsis thaliana	sp\|Q8GYA6\|PS13B_ARATH 26S proteasome non-ATPase regulatory subunit 13 homolog B	82.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card