TkA06G028000 | RubberDandelionOmics

Gene overview

TkA06G028000

Reference: TK1151 Chr: Chr06 Coordinates: 7570683-7573732 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1525 bp · TkA06G028000|TK1151|cDNA

ATCTCATGAGAAAGCTCCATTTGTTTAGTTAACTTTGGTTCCCAAATTTATTCTTGTCTTCAAAGCATAATCCCACAACTAACTTCAATAAGTTCTCAAAGAATTTATTTAGATACACGATGTATGGGTGTATATATGTTTGAAACTTTTAGTACTTTTGCCTTTTGAGTGTGGGGAATTCATTCCGTGGTTGCTTCTTTCCTTCTGTCTTTGTTGTACAAAAGAAAGAACCCATCCATAAATAAACAAAATTCCCAAAG...

CDS

Download CDS FASTA

837 bp · TkA06G028000|TK1151|CDS

ATGGATGGCAGGTACGGCGGCGGCGGTGGTGGTGGTGGCGGTGGGTGTTTTGAGTTTGATAGTGGTGGGGTGGTGATGACAAGAGACCCAAAGCCACGGCTCCGATGGACGGCTGATCTTCATGATAGATTTGTTGACGCTGTTACGAAACTTGGTGGCCCTGATAAAGCGACCCCAAAATCGGTGTTGAGATTGATGGGATTAAAGGGGTTGACATTGTACCATTTGAAGAGCCATTTACAGAAGTATAGACTTGGACA...

Protein

Download Protein FASTA

278 aa · TkA06G028000|TK1151|PROTEIN

MDGRYGGGGGGGGGGCFEFDSGGVVMTRDPKPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRLGQQAKKQIGDPNNENSGDSYEHYNLHSTGTSSNSLRANHEQVDIPIADALLCQIEAQKRLQEQFEVQKKLQMRIETQGKYLQGILENAQKSLSLDMNSSGNLEATRAELTNFNLALSDLMDNLNGEGREENVSKFSHDVKKGPTITHVKEEMKIKTEGGGGGGSISFDLNTGGNY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G028000`
TK1151 ID	TkA06G028000
OH-1004 ID	LXL04_026089
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA06G028000

Location Chr06:7570683-7573732 (-)

Description Similar to PHL11: Myb family transcription factor PHL11

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45580`	Myb family transcription factor PHL11.	No verified direct reference in this release
`At3g24120`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At4g13640`	Transcriptional activator.	Arabidopsis PHL2 and PHR1 Act Redundantly as the Key Components of the Central Regulatory System Controlling Transcriptional Responses to Phosphate Starvation.2016 · DOI: 10.1104/pp.15.01336
`At1g79430`	Transcription factor required for phloem identity.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_026089 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0009877 nodulation Biological Process

GO:0009908 flower development Biological Process

GO:0010088 phloem development Biological Process

GO:0010089 xylem development Biological Process

GO:0010468 regulation of gene expression Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0016036 cellular response to phosphate starvation Biological Process

GO:0045893 positive regulation of DNA-templated transcription Biological Process

GO:2000762 regulation of phenylpropanoid metabolic process Biological Process

KEGG gene cross-reference

ath:AT1G79430

ath:AT3G24120

ath:AT4G13640

ath:AT5G45580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.979

Rank 1 · TkA06G028000 · TK1151

Cytoplasm0.075

Rank 2 · TkA06G028000 · TK1151

Cell membrane0.020

Rank 3 · TkA06G028000 · TK1151

Endoplasmic reticulum0.011

Rank 4 · TkA06G028000 · TK1151

Plastid0.009

Rank 5 · TkA06G028000 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00249Myb_DNA-binding33-84 aa

PF14379Myb_CC_LHEQLE130-175 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G028000	`PF00249`	Myb_DNA-binding	33	84	1.3e-08	35.5
TkA06G028000	`PF14379`	Myb_CC_LHEQLE	130	175	1.1e-20	73.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0SVS4`	Arabidopsis thaliana	sp\|C0SVS4\|PHLB_ARATH Myb family transcription factor PHL11	53.700%	Swiss-Prot	High
`Q94A57`	Arabidopsis thaliana	sp\|Q94A57\|PHL2_ARATH Protein PHR1-LIKE 2	54.400%	Swiss-Prot	Medium
`Q8LAJ7`	Arabidopsis thaliana	sp\|Q8LAJ7\|PHL3_ARATH Protein PHR1-LIKE 3	55.800%	Swiss-Prot	Medium
`Q9SAK5`	Arabidopsis thaliana	sp\|Q9SAK5\|APL_ARATH Myb family transcription factor APL	53.400%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card