RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA06G023830
Reference: TK1151 Chr: Chr06 Coordinates: 6478765-6480979 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

840 bp · TkA06G023830|TK1151|cDNA

GATAACTTAAAAATCATATTAAATTCAAACTTGTTACTGTCAACACCCAAGGTATGCTTCTTTTTATTGCCATCTCTTTCTAAGCCTTTGTCCAACTCATATCTCTCTCTCCTCTCCAAAAACTAGCAAAGGTGTGTGCTTGCCCCACCCCCAACTAGTTCACAACATGGAATGGTGCCAGCAAAAGCTTCATCTTTCCACTAAATTTTGCTTCATGTAGATGATGAGAGTGGAAGGGAAGGACTTGTACTTCATGCTTC...

CDS

Download CDS FASTA

516 bp · TkA06G023830|TK1151|CDS

ATGCCAGTTCCTCTAGCTCCATATCCATCTCCTCCCGCACCTCTTACAACCCCTGCTAATGGATCGCAAAGCCAGTTAGTATGTTCAGGGTGTCGAAATCTTCTACTTTACCCTGTCGGAGCTACTTCAGTATGCTGCGCAGTTTGTAATGCCGTCACCTCTGTTCCTCCTCCTGGTACTGAAATGGCTCAGTTGGTTTGTGGAGGCTGCCATACATTGCTCATGTACATCCGTGGTGCGACAAGTGTACAGTGTTCTTG...

Protein

Download Protein FASTA

171 aa · TkA06G023830|TK1151|PROTEIN

MPVPLAPYPSPPAPLTTPANGSQSQLVCSGCRNLLLYPVGATSVCCAVCNAVTSVPPPGTEMAQLVCGGCHTLLMYIRGATSVQCSCCHTINLALEANQVAHVNCGNCRMLLMYQYGARSVKCAVCQFITSVGICGIQWKSHGRKKKTTETTMDKYEDKKDGGENHVRSKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA06G023830
TK1151 IDTkA06G023830
OH-1004 IDLXL04_026162
Relationship / confidenceRbh Sequence Supported / Probable
Protein identity (%)99.200
Protein coverage (%)TK1151 77.778 / OH-1004 91.724
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA06G023830
LocationChr06:6478765-6480979 (+)
DescriptionSimilar to LOL1: Protein LOL1
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g32540 Positive regulator of reactive oxygen-induced cell death.
Antagonistic control of oxidative stress-induced cell death in Arabidopsis by two related, plant-specific zinc finger proteins.2003 · DOI: 10.1073/pnas.1130421100

Rice

Reference gene IDPossible functionPapers / DOI
Os08g0159500 Negative regulator of programmed cell death and hypersensitive response (HR).
OsLSD1, a rice zinc finger protein, regulates programmed cell death and callus differentiation.2005 · DOI: 10.1094/mpmi-18-0375
Os07g0472200 Putative zinc finger that may be involved in programmed cell death and defense response. No verified direct reference in this release
Os03g0639600 Putative zinc finger that may be involved in programmed cell death and defense response. No verified direct reference in this release
Os12g0611000 Putative zinc finger that may be involved in programmed cell death and defense response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_026162 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000303 response to superoxide Biological Process
GO:0001666 response to hypoxia Biological Process
GO:0002240 response to molecule of oomycetes origin Biological Process
GO:0009626 plant-type hypersensitive response Biological Process
GO:0009862 systemic acquired resistance, salicylic acid mediated signaling pathway Biological Process
GO:0010104 regulation of ethylene-activated signaling pathway Biological Process
GO:0010310 regulation of hydrogen peroxide metabolic process Biological Process
GO:0010602 regulation of 1-aminocyclopropane-1-carboxylate metabolic process Biological Process
GO:0010618 aerenchyma formation Biological Process
GO:0030154 cell differentiation Biological Process
GO:0031348 negative regulation of defense response Biological Process
GO:0034051 negative regulation of plant-type hypersensitive response Biological Process
KEGG gene cross-reference
ath:AT1G32540
ath:AT4G20380
dosa:Os03g0639600
dosa:Os08g0159500
dosa:Os12g0611000
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.582
Rank 1 · TkA06G023830 · TK1151
Cytoplasm0.446
Rank 2 · TkA06G023830 · TK1151
Cell membrane0.092
Rank 3 · TkA06G023830 · TK1151
Endoplasmic reticulum0.063
Rank 4 · TkA06G023830 · TK1151
Mitochondrion0.046
Rank 5 · TkA06G023830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06890Phage_Mu_Gp4519-28 aa
PF23547Zn_ribbon_FGT1_125-57 aa
PF06943zf-LSD128-52 aa
PF02150Zn_ribbon_RPB928-52 aa
PF06890Phage_Mu_Gp4553-74 aa
PF23547Zn_ribbon_FGT1_164-90 aa
PF06943zf-LSD167-91 aa
PF02150Zn_ribbon_RPB974-89 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA06G023830PF06890Phage_Mu_Gp4519280.1412.9
TkA06G023830PF23547Zn_ribbon_FGT1_125570.003217.7
TkA06G023830PF06943zf-LSD128523.4e-37126.7
TkA06G023830PF02150Zn_ribbon_RPB928523.98.2
TkA06G023830PF06890Phage_Mu_Gp4553740.1412.9
TkA06G023830PF23547Zn_ribbon_FGT1_164900.003217.7
TkA06G023830PF06943zf-LSD167913.4e-37126.7
TkA06G023830PF02150Zn_ribbon_RPB974893.98.2
TkA06G023830PF23547Zn_ribbon_FGT1_11021270.003217.7
TkA06G023830PF06943zf-LSD11051293.4e-37126.7
TkA06G023830PF02150Zn_ribbon_RPB91051273.98.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93ZB1Arabidopsis thalianasp|Q93ZB1|LOL1_ARATH Protein LOL187.300%Swiss-ProtHigh
Q0J7V9Oryza sativa subsp. japonicasp|Q0J7V9|LSD1_ORYSJ Protein LSD187.200%Swiss-ProtHigh
Q69UP7Oryza sativa subsp. japonicasp|Q69UP7|LOL1_ORYSJ Protein LOL178.900%Swiss-ProtLow
Q6ASS2Oryza sativa subsp. japonicasp|Q6ASS2|LOL3_ORYSJ Protein LOL365.000%Swiss-ProtLow
Q2QMB3Oryza sativa subsp. japonicasp|Q2QMB3|LOL2_ORYSJ Protein LOL268.300%Swiss-ProtLow

JBrowse

View in Genome Browser