TkA06G023250 | RubberDandelionOmics

Gene overview

TkA06G023250

Reference: TK1151 Chr: Chr06 Coordinates: 6373821-6374885 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

871 bp · TkA06G023250|TK1151|cDNA

TAAAACTCAGGCTCAAGTTTGTGATTTGTTACATACTTTTTTGCTCAATTTTGAAATGTTTTTCGGGTATGGCTTCTTGCTTAGCAAAAAGTGTCTGCCTCTTTGGTTGGAACATCGGCAAAAACAAAACCAACGAGAAACCTCAGCCCAATTACCATAATGTTGATCTTCCTTTTCCATCTTTTCTACTCAACAAAACTTTCCTCAATGGGAAAGAATTAAAATGCTGTTACAAGGCCACCTTGGATGGATTTAGTGCG...

CDS

Download CDS FASTA

663 bp · TkA06G023250|TK1151|CDS

ATGGCTTCTTGCTTAGCAAAAAGTGTCTGCCTCTTTGGTTGGAACATCGGCAAAAACAAAACCAACGAGAAACCTCAGCCCAATTACCATAATGTTGATCTTCCTTTTCCATCTTTTCTACTCAACAAAACTTTCCTCAATGGGAAAGAATTAAAATGCTGTTACAAGGCCACCTTGGATGGATTTAGTGCGACTAAATTTCACGAATGTAGTGATTTCAAGGGCCCATGTGTGATTATCGGCTACACAGACAACTCGTT...

Protein

Download Protein FASTA

220 aa · TkA06G023250|TK1151|PROTEIN

MASCLAKSVCLFGWNIGKNKTNEKPQPNYHNVDLPFPSFLLNKTFLNGKELKCCYKATLDGFSATKFHECSDFKGPCVIIGYTDNSFKFGAFNPEGYRSTDDYYETFDAFLFYWANNEDNVPIVLPKVGGSGAALFDYARGGPQFGADGLLIGPPLAPVMGGFAGPDTNSGVGDLKQAKSRLGLSYAKREDGKESLFGDEPRASLEEVLVFCSPQIASLY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA06G023250`
TK1151 ID	TkA06G023250
OH-1004 ID	LXL04_026171
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.100
Protein coverage (%)	TK1151 96.364 / OH-1004 28.154 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA06G023250`
Location	Chr06:6373821-6374885 (-)
Description	Similar to ABCI7: Protein ABCI7, chloroplastic
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_026171` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006979 response to oxidative stress Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0010027 thylakoid membrane organization Biological Process GO:0016226 iron-sulfur cluster assembly Biological Process GO:0009507 chloroplast Cellular Component GO:0009536 plastid Cellular Component GO:0009570 chloroplast stroma Cellular Component GO:1990229 iron-sulfur cluster assembly complex Cellular Component GO:0046872 metal ion binding Molecular Function GO:0051539 4 iron, 4 sulfur cluster binding Molecular Function
KEGG gene cross-reference	ath:AT1G32500 ecj:JW1671 eco:b1681 ecoc:C3026_09630 pfa:PF3D7_1103400 syn:slr0076 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.532

Rank 1 · TkA06G023250 · TK1151

Nucleus0.301

Rank 2 · TkA06G023250 · TK1151

Cell membrane0.130

Rank 3 · TkA06G023250 · TK1151

Extracellular0.123

Rank 4 · TkA06G023250 · TK1151

Endoplasmic reticulum0.103

Rank 5 · TkA06G023250 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07534TLD44-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA06G023250	`PF07534`	TLD	44	147	8.9e-11	42.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card